Identifiers and Description

Gene Model Identifier

TTHERM_00689990

Standard Name

GST46 (Glutathione S-transferase mu 46, TtGSTm46, GSTm46)

Aliases

PreTt23195 | 105.m00162 | 3737.m00074

Description

GST46 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16612.1 3.0011893800784333e-147
Description: glutathione S-transferase domain-containing protein (241 aa)
Oxytricha Contig16299.0.g15 4.997543945741262e-17
Description: Glutathione S-transferase, N-terminal domain
WormBase WBGene00001788 0.000000000500206551404915
Description: locus:gst-40 status:Confirmed UniProt:O45115 protein_id:CCD71946.1
DictyBase DDB_G0274081 0.0000009995106777214876
Description: DDB_G0274081 on chromosome: 2 position 3748941 to 3749724

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00689990(coding)
ATGTCCAATACAGAAGATAAAATAATACTTGGATATTGGGATTACAGAGGTCGTCCATAG
CCTCTAAAGTTTTTATTGGAGTATATGGGTATTCCTTTCGAATAGAAGTATTATTCATAT
GATAACCCTGATGAATGGTATGAAAAAGATAAAAAGACAATTAAACCATTTTCTAACCTT
CCTTATCTCTAAACCAAAGATGGAATTCTAACAGAGACGTGTTCCATAATTAAATATTTG
TTAAAGCGTTTTCCTTAATTCAAAGACCTTTTAGGTAAAGAGTAAGATGAAATATTTGTA
GACTAAATGCTTAGTGTTATGAATGATTTAAGAGATGTCTTAAAAGCTCTTCATTTCAAC
CCAGATGTTCACAAAGTCAAGAGAGATACTTTATTAACAATTCTTCCAAAGATGCTTGAC
TTTAAAGATATACGAGGAGATAAATAGTTCTTATTGCCTTATTTAACTATTGCTGATTTT
GAGCTTGTAGAAATTTTATTACTTTTCAAGCATTTAGATTCAGAACTATTTGACTAACAT
CTATCAAGCTTTGAAAAATTTCTTTAAGATTTTCATAATCTTCCAAGAATAAAAGAGTAT
GTTAGGTCAGATAAATACTAAAAACTACTCACTTTCTTTGCTAAACCTAAAGCTTACCTT
TAAAGTGATAAATTTATCATCGAATACAATAAATAGTTTTTGCAAAATAACACAAAATTG
TGA


>TTHERM_00689990(gene)
ATGTCCAATACAGAAGATAAAATAATACTTGGATATTGGGATTACAGAGGTCGTCCATAG
CCTCTAAAGTTTTTATTGGAGTATATGGGTATTCCTTTCGAATAGAAGTATTATTCATAT
GATAACCCTGATGAATGGTATGAAAAAGATAAAAAGACAATTAAACCATTTTCTAACCTT
CCTTATCTCTAAACCAAAGATGGAATTCTAACAGAGACGTGTTCCATAATTAAATATTTG
TTAAAGCGTTTTCCTTAATTCAAAGACCTTTTAGGTAAAGAGTAAGATGAAATATTTGTA
GACTAAATGCTTAGTGTTATGAATGATTTAAGAGATGTCTTAAAAGCTCTTCATTTCAAC
CCAGATGTTCACAAAGTCAAGAGAGATACTTTATTAACAATTCTTCCAAAGATGCTTGAC
TTTAAAGATATACGAGGAGATAAATAGTTCTTATTGCCTTATTTAACTATTGCTGATTTT
GAGCTTGTAGAAATTTTATTACTTTTCAAGCATTTAGATTCAGAACTATTTGACTAACAT
CTATCAAGCTTTGAAAAATTTCTTTAAGATTTTCATAATCTTCCAAGAATAAAAGAGTAT
GTTAGGTCAGATAAATACTAAAAACTACTCACTTTCTTTGCTAAACCTAAAGCTTACCTT
TAAAGTGATAAATTTATCATCGAATACAATAAATAGTTTTTGCAAAATAACACAAAATTG
TGA


>TTHERM_00689990(protein)
MSNTEDKIILGYWDYRGRPQPLKFLLEYMGIPFEQKYYSYDNPDEWYEKDKKTIKPFSNL
PYLQTKDGILTETCSIIKYLLKRFPQFKDLLGKEQDEIFVDQMLSVMNDLRDVLKALHFN
PDVHKVKRDTLLTILPKMLDFKDIRGDKQFLLPYLTIADFELVEILLLFKHLDSELFDQH
LSSFEKFLQDFHNLPRIKEYVRSDKYQKLLTFFAKPKAYLQSDKFIIEYNKQFLQNNTKL