Identifiers and Description

Gene Model Identifier

TTHERM_00691350

Standard Name

RRM57 (RNA recognition motif-containing protein 57)

Aliases

PreTt02973 | 106.m00113 | 3674.m00026

Description

RRM57 predicted protein; polyadenylate-binding protein 2

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08800.1 9.997329401607134e-86
Description: polyadenylate-binding protein 2 (610 aa)
WormBase WBGene00003902 0.00000000000020009182674645818
Description: locus:pab-1 status:Confirmed UniProt:Q9U302 protein_id:CAA21572.1
Oxytricha Contig21044.0.g17 0.00000000000020009182674645818
Description: RNA recognition motif_ (a_k_a_ RRM, RBD, or RNP domain)
SGD YER165W 0.00000000002000577768187062
Description: PAB1 Poly(A) binding protein, part of the 3-end RNA-processing complex, mediates interactions between the 5 cap structure and the 3 mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G
DictyBase DDB_G0290745 0.0000000010002658722841845
Description: pabpc1B on chromosome: 5 position 4494408 to 4497035

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691350(coding)
ATGTAGAAAAACTCCTCATAAAATTAGAGTACTACTCTTTTTATCCAATCACTCCATTAG
GATGTTACCAAGAATTTACTTTTCAAGTAGTTCAAGAAATTTGGTACTATCGAGTCATTG
AAGCACTTCCCTAAGAACAGAACAGCCTTAGTTGAATTCTAAACTCCTGAAGAAGCACAG
AATGCTAAGTAAAGCCTCAATTACATAAAGCTTCTTGGCAAGGAAATTAATATTATTAAT
TACTAAACTAAGGATGAACTTGAGCAAAAGAAAGATTATAACTTATTAATTCAAAATGTT
CCTTTAGATCTTGAAACCATTACTTTACACAATTTTATGACTAAGTATGGTGAAATAAGC
TCTCTATTACTTAAGAAGGACTAATTAAACTAGAATTTAGGTGATGGTTTTATTCAATTC
GAAACTAAAGAAGCATGCGATAAAATTTTGAAAGAACATGAGTAAAATGGTAAGATTTCT
CTTCCTAACTCTAATATCTCTTTCAATATCTAAAAAAACAACTAAATCAAGTAAAAAAAT
ACAAAAATCATGATTTATGGTTTATTCGAGCATGAAATCGCAGCTGATTAAAAGGAATCC
AAGACTTAATCAATCAATGCCATTTTCGAAGAAATTAAGAAAGACCTTTAAGTTGATTTT
AATTTCTATACTGAATACAACGAAAAAAAGAAGAATTTCTGGGCCAAGGTTGATTTTACA
TACGATGATGATTAGCAAAAAGAAGAGATTTGTAAGATTATTATAGAATAAGTTCAAAAG
AATTTCCATTACTCAGGAGATTAAAGCAAGGGACCTAAGATTGTTAGTTGA


>TTHERM_00691350(gene)
ATGTAGAAAAACTCCTCATAAAATTAGAGTACTACTCTTTTTATCCAATCACTCCATTAG
GATGTTACCAAGAATTTACTTTTCAAGTAGTTCAAGAAATTTGGTACTATCGAGTCATTG
AAGCACTTCCCTAAGAACAGAACAGCCTTAGTTGAATTCTAAACTCCTGAAGAAGCACAG
AATGCTAAGTAAAGCCTCAATTACATAAAGCTTCTTGGCAAGGAAATTAATATTATTAAT
TACTAAACTAAGGATGAACTTGAGCAAAAGAAAGATTATAACTTATTAATTCAAAATGTT
CCTTTAGATCTTGAAACCATTACTTTACACAATTTTATGACTAAGTATGGTGAAATAAGC
TCTCTATTACTTAAGAAGGACTAATTAAACTAGAATTTAGGTGATGGTTTTATTCAATTC
GAAACTAAAGAAGCATGCGATAAAATTTTGAAAGAACATGAGTAAAATGGTAAGATTTCT
CTTCCTAACTCTAATATCTCTTTCAATATCTAAAAAAACAACTAAATCAAGTAAAAAAAT
ACAAAAATCATGATTTATGGTTTATTCGAGCATGAAATCGCAGCTGATTAAAAGGAATCC
AAGACTTAATCAATCAATGCCATTTTCGAAGAAATTAAGAAAGACCTTTAAGTTGATTTT
AATTTCTATACTGAATACAACGAAAAAAAGAAGAATTTCTGGGCCAAGGTTGATTTTACA
TACGATGATGATTAGCAAAAAGAAGAGATTTGTAAGATTATTATAGAATAAGTTCAAAAG
AATTTCCATTACTCAGGAGATTAAAGCAAGGGACCTAAGATTGTTAGTTGA


>TTHERM_00691350(protein)
MQKNSSQNQSTTLFIQSLHQDVTKNLLFKQFKKFGTIESLKHFPKNRTALVEFQTPEEAQ
NAKQSLNYIKLLGKEINIINYQTKDELEQKKDYNLLIQNVPLDLETITLHNFMTKYGEIS
SLLLKKDQLNQNLGDGFIQFETKEACDKILKEHEQNGKISLPNSNISFNIQKNNQIKQKN
TKIMIYGLFEHEIAADQKESKTQSINAIFEEIKKDLQVDFNFYTEYNEKKKNFWAKVDFT
YDDDQQKEEICKIIIEQVQKNFHYSGDQSKGPKIVS