Identifiers and Description

Gene Model Identifier

TTHERM_00691730

Standard Name

MRNO18 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt03011 | 106.m00151 | 3674.m00064

Description

protein kinase; Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al.- 2006).

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17570.1 9.997093137033517e-262
Description: hypothetical protein (947 aa)
Oxytricha Contig19607.0.1.g61 9.997019043202629e-21
Description: MORN repeat
WormBase WBGene00003144 1
Description: locus:max-2 status:Partially_confirmed UniProt:G5EGQ3 protein_id:CAQ35064.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691730(coding)
ATGGGAAAATCTTTAAGTAAAGACAGAAATTATGAAGAGTATCTCCTTCTGTATAGGAAA
ATAGAAAGCGTTAAAGACATTCATTATGGAGATATCGATATAATGGAATCGAAAGATAAA
AAATAGATTATAGCTATGAAAGATAGAAAATTTTAAAACCTTGAGAAATTGAGGGAATAG
TTAGGGCAAATTAGAAAGAGAAGAGACAACACTCATCCTAATTTTATATAGGTTTTAGAG
TATTTTGTGATGAGTGAAGATAATTTTTGTACTTCTATTTCTAGATTGATATGGACAATG
GAGTATATTAAAAAAGACCTTACAGTAGAAATACGTTAGCGTAAGTTGCAACAAATTCCT
TTCGATGTTAGTGAAATCTAATAAATTGCATTTGCTAGCATTTCAGCTTTCGCTAATTTG
TAAAGAGATGGTATTTACTTTAATGATTTGCGAGCTTAAAACATCCTCTTAACAAATAGT
TTAGAGGTTAAAATCTTAGATCCTGTATTTGAACCTAATCCTCCTCTTCTTATTTAAGTA
TTGCAAACTTCCAAGCCTAAAAAGGGCACTTACTTAGCACCAAATTATTTAAAATTTGCA
AAACAAAAGAATATTCCACACAAATTAACAACTCACAAATCAGAATCATTTTCTTTAGGT
TTCGTGTTAATGGAAGCGTGCTTATTGAATGAACAAGATGAATGCTTTGATTTTAGAGAA
GGAACAATTAATCTTGAAAATTATAAAAAGAATATCCAGTAAATTGAAGATACATATGGA
GAAGAAATTAGTTCTATGATAAAAGAAATGACCAATTTTAATGAAAAGCAAAGACTTGAT
TTTATTTAGTTAGAAACAAAGTATAATTTAAACACTAAGTTAGACAAGCCAATGTAATCA
AGTTAATTTTTACAAGGCTATAGCTCGACAAGTAAATTTCCAACTTCTTAATCGTAGTTG
AAGATAAATGGAGATCAGTCAATCAGCCAAATTTCTCATTTAGATTAAAACAAAAAGTCT
GCTTCACAAAAACAAATTAGACCATTGAGATAATTTGATCTGTTAAACAAAAATTCATCA
AAAGAAACAGTTAATACTGATCGCTCGCAAAATACAAAAGAAAAAAACTATTTTTGCAAG
ATTAACTATCAAACATTTTAGCTTTAAAAAATTGGGAGCCTAAACGTTGATCATAAAAAC
TTACCTACTAACAACTCATTTGTTTCAAATGCAGAAAGCTTTATTCCTTTCATCTAGAAT
TTAGATAGCCATTAAAATTTAAGAGATAAATAAACACCTCTGAATAAGAATAAATTTTAA
TAACAGAATAATATTAGTGAAAATAAATAAAATAAATAATAAAATAATTTAAGATCTGAC
TAAGCAATAACTCCAAGACACTCGATTAGCTTTGTGCATCAAGAAAATTTTGAAAACTAT
AATTAAAATACACTTAATGTAAATAAGCAAGATGGATTAAAGGAAAATGATAAAAATGTG
AATGAATTCAAAAAAAATACTAAACTTTAAGGCTAATTATAAAATTTTTATTCAAACATG
AGGAGCTAAAACGATAAAAGTATATTAAATAACACTTAAAAGCTTAATGCAAAGAATAAA
TCAATATCCTAAATGCAAAATAGCCTATTATAGAGCATGAGAATAGATTAAGCAGGTGAA
GACAAAGAAAATTTTAATTCTTCTAATGCTGAAATATTAAAGTGTTTAAAAGATGAAAGT
AATATAGAAAATACTTAAGATGCCTAAGCTTAGAACTAAAATACTTCTCACGAAAGTGTA
TATTTAACTGAAAATAATTTAAATAATCAAAATCAGTAAAATACACCAATATAGCAAACT
ACTAATGATAATACACCAAAAAGACAAATATAAAGTAACATTAAAAACAAATCTTATGAT
TCACCTTACAATTTATTTGGAAATAATTTAAATCCTATTGATGAAGACAAAAATGAAAAA
TACCAAAAAAGTAGCCCATAACTCTAAATATCTGTTACTGCAGATGGTGATATGATAAGT
GCTATTGATCCATAAAGCACTACAACAAAATAATAAAATAACTAGAATTAAACTAACAAT
TTAAATTCTCTTAACAAAAAATTCTTTAACATCAGTGAAATTAAATTTGAGGGAAATGGA
AATTAAAACTCAAATACAACAAATTTCATCAACACAAAATCCTCAGTAGTTCCATACCAA
ACAAACAATTAGCAATAGTCATTCTATAATAATAGTCACTATCAAACTTCCTTTATTGAA
GCATAGTCTATTTATATTTAATAGAGATCAAATTCATAAGTAATTGAAGTCATAGAAGAA
ACATATGAAGATGGATCAGTGTATAGTGGGGAGAAATTTAAAGGAAAGAGGCATGGTAAT
GGAAAATTCTTGTATGCAGATGGAGGTCTATATGAAGGATCATGGTTTGATGGATGCATG
GAAGGGTATGGAAAACTATATTATCCCTCCGGAAAATTAGCCTATGAAGGAGAATGGAAA
AGAGACAAATTTACAGGTTAAGGAGTTGTTTACAATGATACACCTGAAGAATTAGGTGAA
AATCAATCTTTTGACTTTACAGACTTTGACAAAATGGGTGAACATTGGATTTAATATGAA
GGAGGATTTCTTGATGACTAAAAGCAAGGATAAGGTATTTTATACTTGTCAAACGGAAAC
AGATTTATTGGAGGTTTCTTAAATGATATGGTAGAAGGTATAGGTATCTTTGTAAATTAA
GAGGGCAAGGAAATCAAAGCTCATTATTCTCAAAACAAACTATTAAAATTACTCTGA


>TTHERM_00691730(gene)
ATGGGAAAATCTTTAAGTAAAGACAGAAATTATGAAGAGTATCTCCTTCTGTATAGGAAA
ATAGAAAGCGTTAAAGACATTCATTATGGAGATATCGATATAATGGAATCGAAAGATAAA
AAATAGATTATAGCTATGAAAGATAGAAAATTTTAAAACCTTGAGAAATTGAGGGAATAG
TTAGGGCAAATTAGAAAGAGAAGAGACAACACTCATCCTAATTTTATATAGGTTTTAGAG
TATTTTGTGATGAGTGAAGATAATTTTTGTACTTCTATTTCTAGATTGATATGGACAATG
GAGTATATTAAAAAAGACCTTACAGTAGAAATACGTTAGCGTAAGTTGCAACAAATTCCT
TTCGATGTTAGTGAAATCTAATAAATTGCATTTGCTAGCATTTCAGCTTTCGCTAATTTG
TAAAGAGATGGTATTTACTTTAATGATTTGCGAGCTTAAAACATCCTCTTAACAAATAGT
TTAGAGGTTAAAATCTTAGATCCTGTATTTGAACCTAATCCTCCTCTTCTTATTTAAGTA
TTGCAAACTTCCAAGCCTAAAAAGGGCACTTACTTAGCACCAAATTATTTAAAATTTGCA
AAACAAAAGAATATTCCACACAAATTAACAACTCACAAATCAGAATCATTTTCTTTAGGT
AAATTTTGATTCTTTATAATACATGACTGACTGATAATTAATTATTTAAAAACACTCCTT
ATCACTATACTATATTTATCTTTTTGAATGACACTAAATTTATAAATTTATTGTTAAATT
AACTAAATAATTATAAGGTTTCGTGTTAATGGAAGCGTGCTTATTGAATGAACAAGATGA
ATGCTTTGATTTTAGAGAAGGAACAATTAATCTTGAAAATTATAAAAAGAATATCCAGTA
AATTGAAGATACATATGGAGAAGAAATTAGTTCTATGATAAAAGAAATGACCAATTTTAA
TGAAAAGCAAAGACTTGATTTTATTTAGTTAGAAACAAAGTATAATTTAAACACTAAGTT
AGACAAGCCAATGTAATCAAGTTAATTTTTACAAGGCTATAGCTCGACAAGTAAATTTCC
AACTTCTTAATCGTAGTTGAAGATAAATGGAGATCAGTCAATCAGCCAAATTTCTCATTT
AGATTAAAACAAAAAGTCTGCTTCACAAAAACAAATTAGACCATTGAGATAATTTGATCT
GTTAAACAAAAGTATTTCTTTCTTAATTAAAAAAGAGTGTTTTTTTTAATATTTTTATTT
TTAGAGGATTTTATTAAATTTTTTCAATCTTTTTTTTTGGTTGACGAAATATTACTGATT
AATTTTAAATTTTAAATTAATTAGATTCATCAAAAGAAACAGTTAATACTGATCGCTCGC
AAAATACAAAAGAAAAAAACTATTTTTGCAAGATTAACTATCAAACATTTTAGCTTTAAA
AAATTGGGAGCCTAAACGTTGATCATAAAAACTTACCTACTAACAACTCATTTGTTTCAA
ATGCAGAAAGCTTTATTCCTTTCATCTAGAATTTAGATAGCCATTAAAATTTAAGAGATA
AATAAACACCTCTGAATAAGAATAAATTTTAATAACAGAATAATATTAGTGAAAATAAAT
AAAATAAATAATAAAATAATTTAAGATCTGACTAAGCAATAACTCCAAGACACTCGATTA
GCTTTGTGCATCAAGAAAATTTTGAAAACTATAATTAAAATACACTTAATGTAAATAAGC
AAGATGGATTAAAGGAAAATGATAAAAATGTGAATGAATTCAAAAAAAATACTAAACTTT
AAGGCTAATTATAAAATTTTTATTCAAACATGAGGAGCTAAAACGATAAAAGTATATTAA
ATAACACTTAAAAGCTTAATGCAAAGAATAAATCAATATCCTAAATGCAAAATAGCCTAT
TATAGAGCATGAGAATAGATTAAGCAGGTGAAGACAAAGAAAATTTTAATTCTTCTAATG
CTGAAATATTAAAGTGTTTAAAAGATGAAAGTAATATAGAAAATACTTAAGATGCCTAAG
CTTAGAACTAAAATACTTCTCACGAAAGTGTATATTTAACTGAAAATAATTTAAATAATC
AAAATCAGTAAAATACACCAATATAGCAAACTACTAATGATAATACACCAAAAAGACAAA
TATAAAGTAACATTAAAAACAAATCTTATGATTCACCTTACAATTTATTTGGAAATAATT
TAAATCCTATTGATGAAGACAAAAATGAAAAATACCAAAAAAGTAGCCCATAACTCTAAA
TATCTGTTACTGCAGATGGTGATATGATAAGTGCTATTGATCCATAAAGCACTACAACAA
AATAATAAAATAACTAGAATTAAACTAACAATTTAAATTCTCTTAACAAAAAATTCTTTA
ACATCAGTGAAATTAAATTTGAGGGAAATGGAAATTAAAACTCAAATACAACAAATTTCA
TCAACACAAAATCCTCAGTAGTTCCATACCAAACAAACAATTAGCAATAGTCATTCTATA
ATAATAGTCACTATCAAACTTCCTTTATTGAAGCATAGTCTATTTATATTTAATAGAGAT
CAAATTCATAAGTAATTGAAGGTAATTTATAAATATTTACAATAATTATATATTTTTTAT
ATCATTTAATCTTTGTTATATATAGTCATAGAAGAAACATATGAAGATGGATCAGTGTAT
AGTGGGGAGAAATTTAAAGGAAAGAGGCATGGTAATGGAAAATTCTTGTATGCAGATGGA
GGTCTATATGAAGGATCATGGTTTGATGGATGCATGGAAGGGTATGGAAAACTATATTAT
CCCTCCGGAAAATTAGCCTATGAAGGAGAATGGAAAAGAGACAAATTTACAGGTTAAGGA
GTTGTTTACAATGATACACCTGAAGAATTAGGTGAAAATCAATCTTTTGACTTTACAGAC
TTTGACAAAATGGGTGAACATTGGATTTAATATGAAGGAGGATTTCTTGATGACTAAAAG
CAAGGATAAGGTATTTTATACTTGTCAAACGGAAACAGATTTATTGGAGGTTTCTTAAAT
GATATGGTAGAAGGTATAGGTATCTTTGTAAATTAAGAGGGCAAGGAAATCAAAGCTCAT
TATTCTCAAAACAAACTATTAAAATTACTCTGA


>TTHERM_00691730(protein)
MGKSLSKDRNYEEYLLLYRKIESVKDIHYGDIDIMESKDKKQIIAMKDRKFQNLEKLREQ
LGQIRKRRDNTHPNFIQVLEYFVMSEDNFCTSISRLIWTMEYIKKDLTVEIRQRKLQQIP
FDVSEIQQIAFASISAFANLQRDGIYFNDLRAQNILLTNSLEVKILDPVFEPNPPLLIQV
LQTSKPKKGTYLAPNYLKFAKQKNIPHKLTTHKSESFSLGFVLMEACLLNEQDECFDFRE
GTINLENYKKNIQQIEDTYGEEISSMIKEMTNFNEKQRLDFIQLETKYNLNTKLDKPMQS
SQFLQGYSSTSKFPTSQSQLKINGDQSISQISHLDQNKKSASQKQIRPLRQFDLLNKNSS
KETVNTDRSQNTKEKNYFCKINYQTFQLQKIGSLNVDHKNLPTNNSFVSNAESFIPFIQN
LDSHQNLRDKQTPLNKNKFQQQNNISENKQNKQQNNLRSDQAITPRHSISFVHQENFENY
NQNTLNVNKQDGLKENDKNVNEFKKNTKLQGQLQNFYSNMRSQNDKSILNNTQKLNAKNK
SISQMQNSLLQSMRIDQAGEDKENFNSSNAEILKCLKDESNIENTQDAQAQNQNTSHESV
YLTENNLNNQNQQNTPIQQTTNDNTPKRQIQSNIKNKSYDSPYNLFGNNLNPIDEDKNEK
YQKSSPQLQISVTADGDMISAIDPQSTTTKQQNNQNQTNNLNSLNKKFFNISEIKFEGNG
NQNSNTTNFINTKSSVVPYQTNNQQQSFYNNSHYQTSFIEAQSIYIQQRSNSQVIEVIEE
TYEDGSVYSGEKFKGKRHGNGKFLYADGGLYEGSWFDGCMEGYGKLYYPSGKLAYEGEWK
RDKFTGQGVVYNDTPEELGENQSFDFTDFDKMGEHWIQYEGGFLDDQKQGQGILYLSNGN
RFIGGFLNDMVEGIGIFVNQEGKEIKAHYSQNKLLKLL