Identifiers and Description

Gene Model Identifier

TTHERM_00691810

Standard Name

MRS3 (methionyl-tRNA synthetase 3)

Aliases

PreTt03019 | 106.m00159 | 3674.m00072

Description

MRS3 methionyl-tRNA synthetase protein; methionyl-tRNA synthetase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • glutathionylspermidine synthase activity (IEA) | GO:0008885
  • L-histidine:2-oxoglutarate aminotransferase activity (IEA) | GO:0008110

Biological Process

  • lipoate metabolic process (IEA) | GO:0009106
  • negative regulation of biosynthetic process (IEA) | GO:0009890
  • obsolete activation of MAPKKK activity involved in cell wall organization or biogenesis (IEA) | GO:0000197
  • positive regulation of catabolic process (IEA) | GO:0009896

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17560.1 9.997093137033517e-262
Description: methionyl-tRNA synthetase (545 aa)
DictyBase DDB_G0285759 1.000434858898539e-105
Description: mmetS on chromosome: 4 position 3423740 to 3425574
SGD YGR171C 1.9998944264638884e-101
Description: MSM1 Mitochondrial methionyl-tRNA synthetase (MetRS), functions as a monomer in mitochondrial protein synthesis; functions similarly to cytoplasmic MetRS although the cytoplasmic form contains a zinc-binding domain not found in Msm1p
WormBase WBGene00013678 5.000356947592888e-100
Description: status:Partially_confirmed UniProt:B3KYC0 protein_id:CAQ76500.1
Oxytricha Contig9327.0.0.g58 1.99970314379378e-94
Description: tRNA synthetases class I (M)
Stentor Coeruleus SteCoe_6427 0.000000000005109089028063325
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691810(coding)
ATGCTAAGTTCCTTAAATAAATTAGTGCATAGATTTTCTAGTTCAAATAAATAAATTTCC
ATTACTACTCCTATCTTTTATGTGAATTCTCAACCTCACATAGGGCATCTATATACTCTC
ATTCTATCTGATGCTTATCATAAATGGAAACTTATAGACAATTATGAATCTTATTTCTAA
ACAGGTACTGATGAACATGGCTAAAAAATACAAAACTCTGCAAAGTAGGCATAAAAAGAT
CCATAATAATTTGTTGATTAAGTCAGTTAAAAATTTGTTGATTTGGCTTCTTAGTATAGC
ATTAGCTATGATAAATTCAATAGAACATCAGATGTATCACACAAAGAGGGAGTTTAACAT
TTTTGGAATGTGCTAGAAAAAAAGGGATTCATTGATATGAAGAAATACGAAGGGTGGTAT
CATACATCAGATGAAACTTTTGTAGGTGAAAAAGATTTAGTCAAAGACTCCTCTGGAAAG
TTTGTAACACAATCTGGATAACCTGTTGATTGGGTTAGTGAGGAAACTCATATTTTTGTA
TTGGATAAAATAAGAGAAGCCGTTATAAAGTATTTAGAAAATGAAAAGCCTGTATACCCT
GAACACTACAATAATAGTATGATTAAATAACTAGAAGAATTGAAGGATATTTCTATTAGT
AGACCTAAATCTAGATTAACATGGGGTATAACAGTACCTTCAAATGAGAAATACACAATT
TATGTTTGGTTGGATGCTTTGACTAACTATTTAACAGGTTTGGGATATCCAAACAATAAT
ATAAATAAAATTCATTTATCCAATAATTTTTTCCATATAATGGGCAAAGATATTTTGAAG
TTTCATTCAATATTTTGGCCAGCATTTTTACTAGCTGCTGGGTACTCAACACCTTAAAAA
ATTTTGATCCATCATCACTGGATCAAAGACAATCAAAAAATGAGCAAAAGCCTTGGAAAT
GTAGTTGATCCAGTTGAATTAGGAAATAAGTATGGTATCGACAGTGTAAGACTTTACTTT
TTGTCAGAAGGTCCACAAGATTTCGATGCAAATTTTGATGAAGTAGATTTGACTAAAACA
TACAATTTATTTATTGAAGGATTCATTAACTTGATGTCAAGAGTTTTCAATAAGAAAATT
ATCAAAGATGGTAAGATTACTGAAATATCTTGGGTGCTTAACGAATAAGATCTCGAATAT
ATCAGCAAATTCACAACTATCAGTAATAAAATTTAAGAACATCTAGACAAGTGTGATTTT
AGAAGAGGTTATTTTGCTATGTCAGAGCTTTGGGGAATGACAAATAAACTTATGACAGAT
CATGCTCCCTGGTAAAAGGATATTTCAGAAGTAGAAAAACAAAAATCTTCATATCTAATA
TTAGAAAGTGTCAGAGTTCTTTCTATCTTCCTTTATCCATTTATACCTTAATATATTTAG
AACGTCTATTAATTAATGAACATTAAAAATGATCGTATAAATACTAATTACTTACAATTT
AGAATTGTAGATAAGAACAATCTACCTAAGTAATCTTTTGGCTTTGAAGAGTTGTCCTCT
GAATTTTTGAAAGTAGATATTGATAATAAGAAGCTTATTTTTAAGCAAAAGTTTGACTTA
CAAAAAAAGATTTGA


>TTHERM_00691810(gene)
ATGCTAAGTTCCTTAAATAAATTAGTGCATAGAGTAACATAGTTTTAAGCCAAAAAAACA
AAAAATTTACTTTAAATATTTTTATACTTAATTTTTTGAATAGTTTTCTAGTTCAAATAA
ATAAATTTCCATTACTACTCCTATCTTTTATGTGAATTCTCAACCTCACATAGGGCATCT
ATATACTCTCATTCTATCTGATGCTTATCATAAATGGAAACTTATAGACAATTATGAATC
TTATTTCTAAACAGGTAATTTTTATTAGAATTTCAATTTTTAAAATTGTAAACATCGCTT
TTTAATCTACAAAGGTACTGATGAACATGGCTAAAAAATACAAAACTCTGCAAAGTAGGC
ATAAAAAGATCCATAATAATTTGTTGATTAAGTCAGTTAAAAATTTGTTGATTTGGCTTC
TTAGTATAGCATTAGCTATGATAAATTCAATAGAACATCAGATGGTAAGAAAGAATGTTT
TTTTCATAATTTTTTTGAAAATGATTATTGCCATAGCTTCACTGGAAAGTCTTTAAAATA
ATTTGTTTATCATTAATAGTATCACACAAAGAGGGAGTTTAACATTTTTGGAATGTGCTA
GAAAAAAAGGGATTCATTGATATGAGTAATAAATATTTCTCCCAAACGATCAATCAATGT
TTAATAATATTATTTGTTAGAGAAATACGAAGGGTGGTATCATACATCAGATGAAACTTT
TGTAGGTGAAAAAGATTTAGTCAAAGACTCCTCTGGAAAGTTTGTAAATTACTTGTTATT
TATTTATTAGTTTAACTTAGTTCTATTATAAAATTTATTAAATGAAATCTTTGTTAATAG
GTAACACAATCTGGATAACCTGTTGATTGGGTTAGTGAGGAAACTCATATTTTTGTATTG
GATAAAATAAGAGAAGCCGTTATAAAGTATTTAGAAAATGAAAAGCCTGTATACCCTGAA
CACTACAATAATAGTATGATTAAATAACTAGAAGAATTGAAGGTAAATTACTAAATTTAA
TAAATACTTTAAAAAATAATATTTATTATTTTCATGAAAAATTACGCATTATCTAATTTG
TATTAAAAACGCATTATTTTATAATATTAAGGATATTTCTATTAGTAGACCTAAATCTAG
ATTAACATGGGGTATAACAGTACCTTCAAATGAGAAATACACAATTTATGTTTGGTTGGA
TGCTTTGACTAACTATTTAACAGGTTTGGGATATCCAAACAATAATATAAATAAAATTCA
TTTATCCAATAATTTTTTCCATATAATGGGCAAAGATATTTTGAAGTTTCATTCAATATT
TTGGCCAGCATTTTTACTAGCTGCTGGGTACTCAACACCTTAAAAAATTTTGATCCATCA
TCACTGGATCAAAGACAATGTAAAAATAATTTTTAAAACAAAAAACCTCAATAATAATCA
TAAATTAATAAACAGCAAAAAATGAGCAAAAGCCTTGGAAATGTAGTTGATCCAGTTGAA
TTAGGAAATAAGTATGGTATCGACAGTGTAAGACTTTACTTTTTGTCAGAAGGTCCACAA
GATTTCGATGCAAATTTTGATGAAGTAGATTTGACTAAAACATACAATTTATTTATTGAA
GGATTCAGTAATTTAAATTCAATTAAAATAATTAATGCTAAACATAATATTTAATTTCTA
GTTAACTTGATGTCAAGAGTTTTCAATAAGAAAATTATCAAAGATGGTAAGATTACTGAA
ATATCTTGGGTGCTTAACGAATAAGATCTCGAATATATCAGCAAATTCACAACTATCAGT
AATAAAATTTAAGAACATCTAGACAAGTGTGATTTTAGAAGAGGTTATTTTGCTATGTCA
GAGCTTTGGGGAATGACAAATAAACTTATGACAGATCATGCTCCCTGGTAAAAGGATATT
TCAGAAGTAGAAAAACAAAAATCTTCATATCTAATATTAGAAAGTGTCAGAGTTCTTTCT
ATCTTCCTTTATCCATTTATACCTTAATATATTTAGAACGTCTATTAATTAATGAACATT
AAAAATGATCGTATAAATACTAATTACTTACAATTTAGAATTGTAGATAAGAACAATCTA
CCTAAGTAATCTTTTGGCTTTGAAGAGTTGTCCTCTGAATTTTTGAAAGTAGATATTGAT
AATAAGAAGCTTATTTTTAAGCAAAAGTTTGACTTACAAAAAAAGATTTGA


>TTHERM_00691810(protein)
MLSSLNKLVHRFSSSNKQISITTPIFYVNSQPHIGHLYTLILSDAYHKWKLIDNYESYFQ
TGTDEHGQKIQNSAKQAQKDPQQFVDQVSQKFVDLASQYSISYDKFNRTSDVSHKEGVQH
FWNVLEKKGFIDMKKYEGWYHTSDETFVGEKDLVKDSSGKFVTQSGQPVDWVSEETHIFV
LDKIREAVIKYLENEKPVYPEHYNNSMIKQLEELKDISISRPKSRLTWGITVPSNEKYTI
YVWLDALTNYLTGLGYPNNNINKIHLSNNFFHIMGKDILKFHSIFWPAFLLAAGYSTPQK
ILIHHHWIKDNQKMSKSLGNVVDPVELGNKYGIDSVRLYFLSEGPQDFDANFDEVDLTKT
YNLFIEGFINLMSRVFNKKIIKDGKITEISWVLNEQDLEYISKFTTISNKIQEHLDKCDF
RRGYFAMSELWGMTNKLMTDHAPWQKDISEVEKQKSSYLILESVRVLSIFLYPFIPQYIQ
NVYQLMNIKNDRINTNYLQFRIVDKNNLPKQSFGFEELSSEFLKVDIDNKKLIFKQKFDL
QKKI