Identifiers and Description

Gene Model Identifier

TTHERM_00691850

Standard Name

MCF9 (Mitochondrial Carrier Family 9)

Aliases

PreTt03023 | 106.m00163 | 3674.m00076

Description

carrier protein; Mitochondrial carrier protein; putative dicarboxylate/phosphate carrier

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00153 ) Mitochondrial carrier protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17556.1 2.9998475177091926e-177
Description: mitochondrial carrier protein (302 aa)
DictyBase DDB_G0280161 0.0000000000000299873730555305
Description: mcfK on chromosome: 3 position 3035184 to 3036248
WormBase WBGene00007622 0.00000000000004998767099442072
Description: Uncharacterized mitochondrial carrier C16C10.1 status:Confirmed UniProt:Q09461 protein_id:CAA86739.2
SGD YNL003C 0.00000000000059990805086298
Description: PET8 S-adenosylmethionine transporter of the mitochondrial inner membrane, member of the mitochondrial carrier family; required for biotin biosynthesis and respiratory growth
Oxytricha Contig14613.0.g86 0.000000000003998907168546896
Description: Mitochondrial carrier protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691850(coding)
ATGAGTACTCAAACATAACAATAAAAAAAGCAAAGAAACATTCTTCACATTTGTTTAAGC
TCAATGACATCTGCTGCAATAACTAATTCAATATTAGTACCTTTAGATGTAATTAAAATT
AGATTGTAAAAGTCATCTATGGAGTAGAAGGTGGGAAAAGTGTCTTTTTTATCAACTCTT
AAACATATAGTTAAGCAAGAAGGAGTTAAGACACTGTTTAATGGCCTCTAGTATTCAGTT
TATTAAAGTGTTGGATTTAATTTAACAATGTTATTAGTTTATGAAAGATTATCTCATTTT
GTAGAACATAATATAACAAGCAATTCTTATTATAAACCTCTTATCACTTCTGTCTTCTCT
ACATCAATTGGCACTACTTTAGCATTCCCACTCGAATATTGGAAAACTGTATAATAATCA
AATGAAGGAGTTTCCAATAAAAAGGGCTTTTAACTAGGTAATAGAATATACTCTGCCTTA
ATAGTTTCCATATAAAGAAATGTTGGATTTTTCATTTTCTTTTGGCCTATAAGCGAAAAT
GTAAAGAAGTTCTTGATTTAAAAGCATTATTTTTCTGAATTAAAAACCTACTAAAAAGGT
AGTGGAAGTGACAAATAAACTTAATATTTGATTAAAAACTTTATTTTGAATTGGTCTGCT
GGTATTTGCGGGGCCAGTGTTGCTGGTTTCTTGACTTAACCATTCGATGTACTTAAAACT
CGTAAATAAATAAATGAAGTGTATGGAAAATAGGGAAGTATCTAATTAATGACTGATATT
GTAAAAAATGAAGGAGTAAGTCACTTATTTGTAGGCCTTTAACCAAGATTTGTTAAGGTT
TTAGTATATGGAAGTATGTTCTTCTCTATCTATGAAAATTTTTTGCATTTATGTGATTCT
CACCTTCCATTCTGA


>TTHERM_00691850(gene)
ATGAGTACTCAAACATAACAATAAAAAAAGCAAAGAAACATTCTTCACATTTGTTTAAGC
TCAATGACATCTGCTGCAATAACTAATTCAATATTAGTACCTTTAGATGTAATTAAAATT
AGATTGTAAAAGTCATCTATGGAGTAGAAGGTGGGAAAAGTGTCTTTTTTATCAACTCTT
AAACATATAGTTAAGCAAGAAGGAGTTAAGACACTGTTTAATGGCCTCTAGTATTCAGTT
TATTAAAGTGTTGGATTTAATTTAACAATGTTATTAGTTTATGAAAGATTATCTCATTTT
GTAGAACATAATATAACAAGCAATTCTTATTATAAACCTCTTATCACTTCTGTCTTCTCT
ACATCAATTGGCACTACTTTAGCATTCCCACTCGAATATTGGAAAACTGTATAATAATCA
AATGAAGGAGTTTCCAATAAAAAGGGCTTTTAACTAGGTAATAGAATATACTCTGCCTTA
ATAGTTTCCATATAAAGAAATGTTGGATTTTTCATTTTCTTTTGGCCTATAAGCGAAAAT
GTAAAGAAGTTCTTGATTTAAAAGCATTATTTTTCTGAATTAAAAACCTACTAAAAAGGT
AGTGGAAGTGACAAATAAACTTAATATTTGATTAAAAACTTTATTTTGAATTGGTCTGCT
GGTATTTGCGGGGCCAGTGTTGCTGGTTTCTTGACTTAACCATTCGATGTACTTAAAACT
CGTAAATAAATAAATGAAGTGTATGGAAAATAGGGAAGTATCTAATTAATGACTGATATT
GTAAAAAATGAAGGAGTAAGTCACTTATTTGTAGGCCTTTAACCAAGATTTGTTAAGGTT
TTAGTATATGGAAGTATGTTCTTCTCTATCTATGAAAATTTTTTGCATTTATGTGATTCT
CACCTTCCATTCTGA


>TTHERM_00691850(protein)
MSTQTQQQKKQRNILHICLSSMTSAAITNSILVPLDVIKIRLQKSSMEQKVGKVSFLSTL
KHIVKQEGVKTLFNGLQYSVYQSVGFNLTMLLVYERLSHFVEHNITSNSYYKPLITSVFS
TSIGTTLAFPLEYWKTVQQSNEGVSNKKGFQLGNRIYSALIVSIQRNVGFFIFFWPISEN
VKKFLIQKHYFSELKTYQKGSGSDKQTQYLIKNFILNWSAGICGASVAGFLTQPFDVLKT
RKQINEVYGKQGSIQLMTDIVKNEGVSHLFVGLQPRFVKVLVYGSMFFSIYENFLHLCDS
HLPF