Identifiers and Description

Gene Model Identifier

TTHERM_00693080

Standard Name

CYC17 (CYClin 17)

Aliases

PreTt02891 | 107.m00071 | 3753.m00365

Description

CYC17 amine-terminal domain cyclin; Cyclin; N-terminal domain containing protein; the only meiosis-specific cyclin with a complete cyclin core; essential for anaphase initiation and chromosome segregation

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18399.1 3.0009061039838537e-46
Description: hypothetical protein (748 aa)
Oxytricha Contig19198.0.1.g26 9.99967697349061e-30
Description: Cyclin, N-terminal domain
SGD YPR119W 4.998021988471165e-24
Description: CLB2 B-type cyclin involved in cell cycle progression; activates Cdc28p to promote the transition from G2 to M phase; accumulates during G2 and M, then targeted via a destruction box motif for ubiquitin-mediated degradation by the proteasome
DictyBase DDB_G0275493 3.0007793728221555e-22
Description: cycB on chromosome: 2 position 6000211 to 6001649
WormBase WBGene00000866 1.000116773704384e-19
Description: locus:cyb-2.1 status:Partially_confirmed UniProt:O45926 protein_id:CAA15975.2
Stentor Coeruleus SteCoe_21825 0.000000000000001713908431542013
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64
  2. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00693080(coding)
ATGTGGGAGAGTAAAATTGAACATAATAGGAGGAGCTAACATTTCCTATCTTAAAATAAT
TTCCAAGACAAAAAAGAAAACATTTAGTAGCCCCCTTTCAAAAACTATGTTTTAGGAGAA
AAAACATAAAAAGTACAGTAAATTAATTAATTGGAAACACAAGAATTCCAACAAAGAGGA
ACCAACAAACATAGAGTATTTGGAAGGGTCATAAATGAAAATGGAGTAAATAGCAATAAC
TATTTTCATAGTTAGCCTTTACAAAAGCAATTTAAGGTTTTTAATCCGTTTGCTTAAGAC
TTCAACTTACTTCAAGACGATCAAAATAAAGAAAATGTATTAACATTTTAGCACAATTTT
CAGAGTGAAGTTCATAAAAATCAATAAACGAAGAATATTAATCAAGAAATTAATAAAGAA
TTAGCTTAATCTGAAAAAAGCTTTTAGATGATTGATGAGAGTGAAAAAATTAACTCCTCA
TCAGAAAGTTAATTGATATAAAATATTTTAAATCTTGACCTTTTAAACACTTCTCAAAGT
ATGATTGAGTAAAATCAAAACTAATTAATTAATTTTTGCTAAGAAAATGACAAATTGAAA
GAATTTCACATTATCAACGAAACAAATTATAACACACTCAAAAGTACTTAAATAGAAAAA
ATTAATTTTTTTGATCGATAATTCATTTCGAATCCAATTTATGTAGCTGAATATGCATAA
GAAATATTCGAATATTTGTAAGCTCATCAAGAGAGATATTTATGTAAAGATAACGTAGAC
CTAAAAGACATGCATACTTAGATAAATGAAACTATGAGATGTATTCTTATTGACTGGCTT
ACTGAAGTTTCCATAAAATACGAATTGAAAGAAGAAACCATCTTCATGTGTATATACATG
CTAGATATCTATTGCAGACTATGCTATCAGGATGGAATACAAATATTAAGAGACCACTAT
TAAAAGATTGGTGTTTCTTGCTTGTATATTTCAAGCAAACTAGAAGAAATTTATCCTCCT
GGAGTAAAAGAATTTGTTAAAATTTGTGATGGAGCTTACAAACTAAAAGATATTATAAGC
ACAGAAACAGATATATGCCTAAAATTATAATTTAACTTCTCCTTTCCTACGCCATTTACA
TTTTTTGTAAGATATTCTAAAATTCTAGGTCACAGTAATCTGCAATATTATCAAGGATTA
TTTATCTTGTATCTTTGTTTTATGCACTCTGAACTCAGTCCAATGTACGTTAAATCCTCA
ATAATTGCTTCTTGTAGTTGCTTTTTAGTTGAAAGCGTTGCTGAAAATATTTGGGACGAA
AAAATTAAATCTCTTTCCTCAATCGTCTACCTTCACCCTACTTCTGATTTTTAATTCTTA
ATGCCAAGCATCCATAAACTAATTTAACTTTATTCGAATCCTTAGTTTCCTTTTGAGGCA
ATTAGAAAAAAGTTTTCATCTGATTCATTTTGTAAAGTTTCTACCACTTTTACCTAAAAC
ATTTCTGATAGCTAAAAAAATTCCTAATAATAATCTTAACAACTAACCAATATTTGA


>TTHERM_00693080(gene)
ATGGTAAAATAATTTATAAGAAGTAGAATGATTTCATTTTTATTTATTTTAATATTGCAT
AGTGGGAGAGTAAAATTGAACATAATAGGAGGAGCTAACATTTCCTATCTTAAAATAATT
TCCAAGACAAAAAAGAAAACATTTAGTAGCCCCCTTTCAAAAACTATGTTTTAGGAGAAA
AAACATAAAAAGTACAGTAAATTAATTAATTGGAAACACAAGAATTCCAACAAAGAGGAA
CCAACAAACATAGAGTATTTGGAAGGGTCATAAATGAAAATGGAGTAAATAGCAATAACT
ATTTTCATAGTTAGCCTTTACAAAAGCAATTTAAGGTTTTTAATCCGTTTGCTTAAGACT
TCAACTTACTTCAAGACGATCAAAATAAAGTAAATAAAATTTACTTCTAAGAAGCACTTT
TTAAATATTTAAAAAATATAGGAAAATGTATTAACATTTTAGCACAATTTTCAGAGTGAA
GTTCATAAAAATCAATAAACGAAGAATATTAATCAAGAAATTAATAAAGAATTAGCTTAA
TCTGAAAAAAGCTTTTAGATGATTGATGAGAGTGAAAAAATTAACTCCTCATCAGAAAGT
TAATTGATATAAAATATTTTAAATCTTGACCTTTTAAACACTTCTCAAAGTATGATTGAG
TAAAATCAAAACTAATTAATTAATTTTTGCTAAGAAAATGACAAATTGAAAGAATTTCAC
ATTATCAACGAAACAAATTATAACACACTCAAAAGTACTTAAATAGAAAAAATTAATTTT
TTTGATCGATAATTCATTTCGAATCCAATTTATGTAGCTGAATATGCATAAGAAATATTC
GAATATTTGTAAGCTCATCAAGTAAACAAACAAATAAACTTACTTAAAATAGCTTAAAAT
TTTTAATTGTTTTATTTATTACATAAAAGGAGAGATATTTATGTAAAGATAACGTAGACC
TAAAAGACATGCATACTTAGATAAATGAAACTATGAGATGTATTCTTATTGACTGGCTTA
CTGAAGTTTCCATAAAATACGAATTGAAAGAAGAAACCATCTTCATGTGTATATACATGC
TAGATATCTATTGCAGACTATGCTATCAGGATGGAATACAAATATTAAGAGACCACTATT
AAAAGATTGGTGTTTCTTGCTTGTATATTTCAAGCAAACTAGAAGAAATTTATCCTCCTG
GAGTAAAAGAATTTGTTAAAATTTGTGATGGAGCTTACAAACTAAAAGATATTATAAGCA
CAGAAACAGATATATGCCTAAAATTATAATTTAACTTCTCCTTTCCTACGCCATTTACAT
TTTTTGTAAGATATTCTAAAATTCTAGGTCACAGTAATCTGCAATATTATCAAGTTAATT
ATTTCATTTAGAATAAATTTTTCAACTTATTACTTACTAAAAAACTAATAAAAACTATTT
TAATCTTTTTAAAATAGGGATTATTTATCTTGTATCTTTGTTTTATGCACTCTGAACTCA
GTCCAATGTACGTTAAATCCTCAATAATTGCTTCTTGTAGTTGCTTTTTAGTTGAAAGCG
TTGCTGAAAATATTTGGGACGAAAAAATTAAATCTCTTTCCTCAATCGTCTACCTTCACC
CTACTTCTGATTTTTAATTCTTAATGCCAAGCATCCATAAACTAATTTAACTTTATTCGA
ATCCTTAGTTTCCTTTTGAGGCAATTAGAAAAAAGTTTTCATCTGATTCATTTTGTAAAG
TTTCTACCACTTTTACCTAAAACATTTCTGATAGCTAAAAAAATTCCTAATAATAATCTT
AACAACTAACCAATATTTGA


>TTHERM_00693080(protein)
MWESKIEHNRRSQHFLSQNNFQDKKENIQQPPFKNYVLGEKTQKVQQINQLETQEFQQRG
TNKHRVFGRVINENGVNSNNYFHSQPLQKQFKVFNPFAQDFNLLQDDQNKENVLTFQHNF
QSEVHKNQQTKNINQEINKELAQSEKSFQMIDESEKINSSSESQLIQNILNLDLLNTSQS
MIEQNQNQLINFCQENDKLKEFHIINETNYNTLKSTQIEKINFFDRQFISNPIYVAEYAQ
EIFEYLQAHQERYLCKDNVDLKDMHTQINETMRCILIDWLTEVSIKYELKEETIFMCIYM
LDIYCRLCYQDGIQILRDHYQKIGVSCLYISSKLEEIYPPGVKEFVKICDGAYKLKDIIS
TETDICLKLQFNFSFPTPFTFFVRYSKILGHSNLQYYQGLFILYLCFMHSELSPMYVKSS
IIASCSCFLVESVAENIWDEKIKSLSSIVYLHPTSDFQFLMPSIHKLIQLYSNPQFPFEA
IRKKFSSDSFCKVSTTFTQNISDSQKNSQQQSQQLTNI