Identifiers and Description

Gene Model Identifier

TTHERM_00697490

Standard Name

RPL14 (Ribosomal protein of the large subunit)

Aliases

PreTt17541 | 108.m00193 | 3818.m00726 | RPL14e

Description

RPL14 60S ribosomal protein L14; Homolog of yeast RPL14/(RPL14e)

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18115.1 1.0002335610448659e-38
Description: hypothetical protein (88 aa)
Oxytricha Contig22158.0.g4 6.999211576891585e-27
Description: Ribosomal protein L14
SGD YHL001W 2.000620012690291e-23
Description: RPL14B Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl14Ap and has similarity to rat L14 ribosomal protein
WormBase WBGene00004426 2.9990241513684e-21
Description: locus:rpl-14 status:Confirmed UniProt:Q9XVE9 protein_id:CAB03835.1
DictyBase DDB_G0277975 3.998609120989657e-17
Description: rpl14 on chromosome: 3 position 87206 to 87758

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00697490(coding)
ATGTCCCATTATTTTGTTCCTATGTTAATGAGTTATTTTGTTAAAATTAAAAAGGTTTTC
AACAAATTCGTTCAAGTCGGTAGAGTCGTTTACATCAACTACGGTGCTGATAAGGGTAAA
CTCGCTGTTATCGTTAACATCATCAACTAAAACAGAATCCTTATTGATGGTGAACACATT
GTTAGACAAGTTATTCCCATCAGAAGAGTCCACCTTACCAAGTTCTAAATTGATAATGTT
GAACTCAACCAAAGAACCGTCTTATTGAAGAAGAAGATCGCTAAGTTCGACTTAACCAAG
AAGTACGCTGAAACCTCCTTCGCTAAGAAGTAAGCTATCAAGACCAAGAGAGCTAACCTC
GGTGATTTCGATAGATTCAGAGTTATGGTTCTTAAGAAGAAGCTCGCTAGAACCAGCGCT
AAGTCTAAGTGA


>TTHERM_00697490(gene)
ATGTCCCATTATTTTGTTCCTATGTTAATGAGTTATTTTGTTAAAATTAAAAAGGTTTTC
AACAAATTCGTTCAAGTCGGTAGAGTCGTTTACATCAACTACGGTGCTGATAAGGGTAAA
CTCGCTGTTATCGTTAACATCATCAACTAAAACAGAATCCTTATTGATGGTGAACACATT
GTTAGACAAGTTATTCCCATCAGAAGAGTCCACCTTACCAAGTTCTAAATTGATAATGTT
GAACTCAACCAAAGAACCGTCTTATTGAAGTAGAGATATTCTTATATTTTTTACTATATT
TTTAAAAAGCTCAAAATTCTCTAAATCATCATCTCACACATTAAATGGATTATTTTACAA
ATGCACTCAGAAAATTTGAATTTGGTATTATCAAGCTAATTTTTAATCTACAATTAGCAA
ATCTAAGTAGAAATCTATTTAATTGCTTGAAGCATGAGTGAATTGTTTTGCAAAGGAAAA
ATTGCTGTAAATAGATTCAAAATAGTAATAAAAAGGGAATTTAACAAATAAGTTGGAGTA
ATTTAAAAAAACTCTTAAGCAAGAAACGGATTTGAAATTAGAATTTCATAAAAGTCTAAC
AATAGGCATACTTAGCTTTGAAAAGTATAAATAATAATCAAATGAGACGCAATACTGAAT
AGTGATCTATGTTTTAGTTTAATTCAAGCAAAGTATAGGAAAAGAATAAAAAGCATTTTC
GTAACAATAAGTTTATTTTGAAATATGAACTAGTCTTGAATTTTGTTTTCAAATTTAAAA
CCTTTTACTTTCTTAGTAAGTAATATTTAGCAACAAATATCTTCAAATTAATTTATTATT
AGTTAGAAGGAAATAAATAATTCAAGCTAAGTATTAAAGTAAGTAGAGAGAATGAGGATA
ACATTTATGATAAATGCGTTTTTTCCAGATCTTAAATAAATGATACCGTTTATTGTTTGA
ATTAAGCAATTTGTTAAATTCTAGCTAAAAAATTTAGTTTTTGAATGAAAAAATAAAGAA
AAATACAAAATGAATCTATCTATTAATTAACCAATCTATCTATTAATAAATCAATCTACT
TTCTAAAATATCAATTAATGTGTTGAAGATGAGTGATAAAAGAATTCAAAAAATATAAAT
ACATACTTACTTAACAATTTCTAAACATTACTAATATTTTTAAATAGGAAGAAGATCGCT
AAGTTCGACTTAACCAAGAAGTACGCTGAAACCTCCTTCGCTAAGAAGTAAGCTATCAAG
ACCAAGAGAGCTAACCTCGGTGATTTCGATAGATTCAGAGTTATGGTTCTTAAGAAGAAG
GTAAATAATTAATTATGAAATAAATCTGAAACAAATAAAAATATTTTCTTATTTTAAATA
AAGCTCGCTAGAACCAGCGCTAAGTCTAAGTGA


>TTHERM_00697490(protein)
MSHYFVPMLMSYFVKIKKVFNKFVQVGRVVYINYGADKGKLAVIVNIINQNRILIDGEHI
VRQVIPIRRVHLTKFQIDNVELNQRTVLLKKKIAKFDLTKKYAETSFAKKQAIKTKRANL
GDFDRFRVMVLKKKLARTSAKSK