Identifiers and Description

Gene Model Identifier

TTHERM_00698640

Standard Name

MRNO04 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt14859 | 109.m00077

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01256.1 1.000296925633081e-74
Description: hypothetical protein (495 aa)
Oxytricha Contig14161.0.g64 0.000009999254677478949
Description: MORN repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00698640(coding)
ATGAATTAATTAGCATGTAATACATAAAATGTGAATGGGTAATAATACATGGGCAACAAC
AATTAATTTGTATTTGAGAATTAAATAAAATAAGCACTCAGCAATTTTGATTAGCAATTT
GAGTAAAATTAAAAAAGACTTAATGAGTTTATACAAGAATAAAAGGAGATCATGAGATAA
TAATTTGAATAATTTTTGAGAGATGAACCCTAAAATGTGCTGTAATTTATCAGAGGTTAG
ATTGAACCCATATAGAAGCTATTTGATTGTATTAATGATAGCATAAAACAATAATACAGC
TAAAATGAAACTTAGGTTAATATCGATTTTACTTCTTATTTGGATAAATTTGGCATTCCA
GATTTCATGAGAGAGCAACTAAAAAAGTTCAATTTTAATTTAGATGAATTTGAAAATGCG
GAGTCTTAGGATTTGATAGAAGAGGACAGAGAGAAATCACTAATTATTGGACAGAAAGAT
AATAAAAACTAATACAGTGGTAGAGCTCTTATCATTTACAAAAGTGATCCAGCAGCGATT
TATTTAGGATATATGAAAGATAACAAACGTCATGGAAGAGGTATTCTTGTCTTGAATGGA
TTTTAGTACTACTTAGGAGAATTCTACAATAACAAAGAATGGGGTTATGGAGAAATACAA
TTAATTAACAAAGAAAACAAGAATGAGAAGTATGTTGGTTACTTCTCTGAAGGCAAGAGA
TGTGGTTCAGGTTAGTAAGTGAATTTGGACACTAATACTAAAGAAGAATCAACTTATGTA
TCAGTTAATTATTTTAATGAGAGTCTCCATGGACCTAGAGTTCAAAGTTTTGGATAAAGT
TAATAATACAAATTCTAGCTCTTCTAGTATGAAAAGAATTACTTCTCCTTTAAAGATCAA
TGGAGTGATAAGGCTCCTTTATAAAATATTTTTGTATCTACCAAAGGCAAAACAGAAGGC
TAGGCTCTGAATTTGTCTCCTGAGCTTTCTATTGACCACTCATTCAAAGAAGATCAATAG
ATTAATTAAGAACAACCAAATCCTTATGAGATTCCTTCTATTAACTAGAACAACTTTCCC
TAAAATTAATAATTTGGATAACAAAATTTCTAAAATAACCCATATTTTATGGCTCCACCT
TAAAATTACATGCAAAATCCATAAAATTTCATGCCACCATAACAAGGTATTCCTTTTCCA
CCACAATACCCATATTAAAACCCATAACAATAGTTTCCACTTAATCCAAATGCTTAATTT
TAATAATAATAAGTTTATAAGAGCGTAATTAAACAAGTTATTTTTGATAACATTAATAAA
TAATGA


>TTHERM_00698640(gene)
ATGAGTACAAACCCAAAATAAATATAAAATAACCATTTATACTATAGCGGATATTATTTT
TAAGACATTTAATTTATAAAAAGAATATAAAATACCATCGGTCTTTATTTAACAATGATA
TTAGATTTTATTTATATCATCTTTATCAAAAAAAATTTATTATTATTGTAAAAAATTACC
TCTAAAAAGGCATTTTTTAATTAAGCTTTTTACCTTTTAAATGAGCAATGAATCTTATTG
AATAGTAAATTGCTTAGATAATTTACAAATTAAAAAAAAATAAGATACACTAATTAAAAA
TAAAAGAAAACAATAAACACATATAGGTAAAAGATATTAGTGATTTATTTTTTTTGTAGT
GAGATTGTGGAACGCCCTTTGATTTGATCTAAATTTTGTTAATATTCTAACAATTTTTAA
AAAAAATAAAATTTAAAAGCAATTGCGAAAAGGAAAAACAATCTAATAAACATACAAATA
ATATATCGAATATAAATAATTCTTTGATAAAGACAAAATACTTTAATAATAAGATAAATA
AAAATTTTTAAAGACAATCTTTTAGTTTGTTAATAGATAAAATAGATTCGAAATAGAGAA
AATAAATAACAGAATTAGACTAACCTCTTTTTGCACTCAAAATGAATTAATTAGCATGTA
CATTAAACTAACATTTATCATTTTTAATAGGAAAATGCACAAATTATAGTTGTGGACATG
AAATTTGCAATGCTTGCATAGATAATCATAAACTTCACAGAAATTGCATTATGATGTATT
AATAAAATTTTTAAAATTAAGGTAATACATAAAATGTGAATGGGTAATAATACATGGGCA
ACAACAATTAATTTGTATTTGAGAATTAAATAAAATAAGCACTCAGCAATTTTGATTAGC
AATTTGAGTAAAATTAAAAAAGACTTAATGAGTTTATACAAGAATAAAAGGAGATCATGA
GATAATAATTTGAATAATTTTTGAGAGATGAACCCTAAAATGTGCTGTAATTTATCAGAG
GTTAGATTGAACCCATATAGAAGCTATTTGATTGTATTAATGATAGCATAAAACAATAAT
ACAGCTAAAATGAAACTTAGGTTAATATCGATTTTACTTCTTATTTGGATAAATTTGGCA
TTCCAGATTTCATGAGAGAGCAACTAAAAAAGTTCAATTTTAATTTAGATGAATTTGAAA
ATGCGGAGTCTTAGGATTTGATAGAAGAGGACAGAGAGAAATCACTAATTATTGGACAGA
AAGATAATAAAAACTAATACAGTGGTAGAGCTCTTATCATTTACAAAAGTGATCCAGCAG
CGATTTATTTAGGATATATGAAAGATAACAAACGTCATGGAAGAGGTATTCTTGTCTTGA
ATGGATTTTAGTACTACTTAGGAGAATTCTACAATAACAAAGAATGGGGTTATGGAGAAA
TACAATTAATTAACAAAGAAAACAAGAATGAGAAGTATGTTGGTTACTTCTCTGAAGGCA
AGAGATGTGGTTCAGGTTAGTAAGTGAATTTGGACACTAATACTAAAGAAGAATCAACTT
ATGTATCAGTTAATTATTTTAATGAGAGTCTCCATGGACCTAGAGTTCAAAGTTTTGGAT
AAAGTTAATAATACAAATTCTAGCTCTTCTAGTATGAAAAGAATTACTTCTCCTTTAAAG
ATCAATGGAGTGATAAGGCTCCTTTATAAAATATTTTTGTATCTACCAAAGGCAAAACAG
AAGGCTAGGCTCTGAATTTGTCTCCTGAGCTTTCTATTGACCACTCATTCAAAGAAGATC
AATAGATTAATTAAGAACAACCAAATCCTTATGAGATTCCTTCTATTAACTAGAACAACT
TTCCCTAAAATTAATAATTTGGATAACAAAATTTCTAAAATAACCCATATTTTATGGCTC
CACCTTAAAATTACATGCAAAATCCATAAAATTTCATGCCACCATAACAAGGTATTCCTT
TTCCACCACAATACCCATATTAAAACCCATAACAATAGTTTCCACTTAATCCAAATGCTT
AATTTTAATAATAATAAGTTTATAAGAGCGTAATTAAACAAGTTATTTTTGATAACATTA
ATAAATAATGA


>TTHERM_00698640(protein)
MNQLACNTQNVNGQQYMGNNNQFVFENQIKQALSNFDQQFEQNQKRLNEFIQEQKEIMRQ
QFEQFLRDEPQNVLQFIRGQIEPIQKLFDCINDSIKQQYSQNETQVNIDFTSYLDKFGIP
DFMREQLKKFNFNLDEFENAESQDLIEEDREKSLIIGQKDNKNQYSGRALIIYKSDPAAI
YLGYMKDNKRHGRGILVLNGFQYYLGEFYNNKEWGYGEIQLINKENKNEKYVGYFSEGKR
CGSGQQVNLDTNTKEESTYVSVNYFNESLHGPRVQSFGQSQQYKFQLFQYEKNYFSFKDQ
WSDKAPLQNIFVSTKGKTEGQALNLSPELSIDHSFKEDQQINQEQPNPYEIPSINQNNFP
QNQQFGQQNFQNNPYFMAPPQNYMQNPQNFMPPQQGIPFPPQYPYQNPQQQFPLNPNAQF
QQQQVYKSVIKQVIFDNINKQ