Identifiers and Description

Gene Model Identifier

TTHERM_00700970

Standard Name

PRP4 (pre-mRNA processing factor 4)

Aliases

PreTt14894 | 109.m00112

Description

PRP4 U4 U6 small nuclear ribonucleoprotein Prp4; U4/U6 small nuclear ribonucleoprotein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF01839 ) FG-GAP repeat
  • ( PF08799 ) pre-mRNA processing factor 4 (PRP4)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01239.1 9.997093137033517e-262
Description: hypothetical protein (536 aa)
Oxytricha Contig6514.0.g50 7.002925050786358e-139
Description: WD domain, G-beta repeat
WormBase WBGene00007972 1.999469658314961e-75
Description: locus:prp-4 status:Partially_confirmed UniProt:Q93339 protein_id:CAB02270.1
DictyBase DDB_G0287635 6.000034430729774e-56
Description: prpf4 on chromosome: 5 position 533367 to 535169
SGD YPR178W 7.997143886232904e-48
Description: PRP4 Splicing factor, component of the U4/U6-U5 snRNP complex
Stentor Coeruleus SteCoe_34005 4.359610000063081e-28
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00700970(coding)
ATGTCTTCAGATAAGCAAGAAGAGAGAATCTATTATGGTTCTCTTGAAGAATAGGAGAGA
CAAAGAATAATAGATGAAGAAAAGCAAAAATAAGAAAGAAAATAGCAATAAGCTTCTCAA
TCTGCTCCTAATAGCAGCTCAGATTAATAATAATCATAATAAGTCTAAACAGGATAATTA
AAAAGCTTGGGAGGAAAGTAATTAAAATCTTTAGCTGACAAAGATAAGTCACAAACAAAT
GTGTAGATAGAAGTATTGGAATTATCAGAACATGCTCTAGAAGAAAAGAGAAGACATGAT
GAAAATATGAGAAAGTTAGAACTTCAAAAAAAAGCATCAACTATGATTGTACCTACAAAT
GATAAAGAAGTAAAATATAGATTGAGATAATTAGGTCATCCTATTTGCTACTTTGGTGAA
AATAATGCTGACAGAAGAGAGCGTTTGAAAAAGGTTTAAGCTGAATATATTATGGAACAC
GGCGATTTACCTCAATTTATTAAATTAGAAGAAAAGCAAAAGTAAAATGATGAGAATGAA
CATTTCTACTACCCAGGTATTAAAGAATTGAAAGAAATTAGAGAAGAAATAGCTACTTAC
TCTCTTCTTAAGTCTTCGCGTAGAGTCTATAAATCTAAAGTTGGTAGAATGGAGGAAGAC
CCATTAGTAGAAGAAAAAAAGCAAATTAGTTCTCTCAACAGAGCTATGAAATTTGATGTT
TGTGTTAGTTAATTCGCTGATTCAAGTATTGTTTTAAGAGGTGCTTTTTCTCCTGAATGT
GATCTTTTAGCAACAGCAGGCGGTTCTGGAGTCTCCAAAATATGGAATATTCCTAATTCA
GATTTAAAATGCAGATTAGAAGGCCATCTTAGTAAGGTCCATGATATTGTTTGGAATCCA
GAAACAGGTAGTATGAGTCATAACTCTTTTGGGCATTTGGCTACAGGATCTAGTGATACA
AATATTCGTTTATGGACTATGGACCCTGCTGCTGAATTATAAAAATCAATTGTTTTAAGT
GGACATGAAGATAGAGTTAATAGACTCAGTTTCCATCAAACAGGAAAATATCTCTTTTCT
ACTTCTCACGATATGACTTGGCGTTTTTGGGACATCGAGCGTCAGAAAGAAATTTACGTA
TAAACTGGTCATACTAAAGGAGTATATGCTAATGCACTTCATCCTGATGGATCTCTTATT
TTTACAGGAGATCTCTAAGGTTATGGAATGATTTGGGATTTAAGAACTGGTAAAGGTATA
CTACCTTTTTCAGGTTATCATGTTAAAGGTATTTTAGCAGCTGATTTCTCTGAAAATGGT
TTCTAATTTGTAACTGGTAGTGAAGATAATACACTTAGAGTATTCGATATTAGAAGAAGG
GCTTGTATGCATACTCTTCCTGGTCATCTTAAACTTATCAGTGATGTTAAATTTTAGAAA
AATGGAAGCAATTACTTTGTCTCTGTTAGTTATGACAACACACTCAAATTATGGAATGCA
AAAGACTTTTCACTAGCCAAAACATATAAATCCCACGAATCTAAAATCACTTCAGTTACC
TTGGATTAATCTCAGAAGTATTTTGCAACTACATCTCTAGATAGAAAGTGGATGTTATGG
GAATATAAAGATTTCTGA


>TTHERM_00700970(gene)
ATGTCTTCAGATAAGCAAGAAGAGAGAATCTATTATGGTTCTCTTGAAGAATAGGAGAGA
CAAAGAATAATAGATGAAGAAAAGCAAAAATAAGAAAGAAAATAGCAATAAGCTTCTCAA
TCTGCTCCTAATAGCAGCTCAGATTAATAATAATCATAATAAGTCTAAACAGGATAATTA
AAAAGCTTGGGAGGAAAGTAATTAAAATCTTTAGCTGACAAAGATAAGTCACAAACAAAT
GTGTAGATAGAAGTATTGGAATTATCAGAACATGCTCTAGAAGAAAAGAGAAGACATGAT
GAAAATATGAGAAAGTTAGAACTTCAAAAAAAAGCATCAACTATGATTGTACCTACAAAT
GATAAAGAAGTAAAATATAGATTGAGATAATTAGGTCATCCTATTTGCTACTTTGGTGAA
AATAATGCTGACAGAAGAGAGCGTTTGAAAAAGGTTTAAGCTGAATATATTATGGAACAC
GGCGATTTACCTCAATTTATTAAATTAGAAGAAAAGCAAAAGTAAAATGATGAGAATGAA
CATTTCTACTACCCAGGTATTAAAGAATTGAAAGAAATTAGAGAAGAAATAGCTACTTAC
TCTCTTCTTAAGTCTTCGCGTAGAGTCTATAAATCTAAAGTTGGTAGAATGGAGGAAGAC
CCATTAGTAGAAGAAAAAAAGCAAATTAGTTCTCTCAACAGAGCTATGAAATTTGATGTT
TGTGTTAGTTAATTCGCTGATTCAAGTATTGTTTTAAGAGGTGCTTTTTCTCCTGAATGT
GATCTTTTAGCAACAGCAGGCGGTTCTGGAGTCTCCAAAATATGGAATATTCCTAATTCA
GATTTAAAATGCAGATTAGAAGGCCATCTTAGTAAGGTCCATGATATTGTTTGGAATCCA
GAAACAGGTAGTATGAGTCATAACTCTTTTGGGCATTTGGCTACAGGATCTAGTGATACA
AATATTCGTTTATGGACTATGGACCCTGCTGCTGAATTATAAAAATCAATTGTTTTAAGT
GGACATGAAGATAGAGTTAATAGACTCAGTTTCCATCAAACAGGAAAATATCTCTTTTCT
ACTTCTCACGATATGACTTGGCGTTTTTGGGACATCGAGCGTCAGAAAGAAATTTACGTA
TAAACTGGTCATACTAAAGGAGTATATGCTAATGCACTTCATCCTGATGGATCTCTTATT
TTTACAGGAGATCTCTAAGGTTATGGAATGATTTGGGATTTAAGAACTGGTAAAGGTATA
CTACCTTTTTCAGGTTATCATGTTAAAGGTATTTTAGCAGCTGATTTCTCTGAAAATGGT
TTCTAATTTGTAACTGGTAGTGAAGATAATACACTTAGAGTATTCGATATTAGAAGAAGG
GCTTGTATGCATACTCTTCCTGGTCATCTTAAACTTATCAGTGATGTTAAATTTTAGAAA
AATGGAAGCAATTACTTTGTCTCTGTTAGTTATGACAACACACTCAAATTATGGAATGCA
AAAGACTTTTCACTAGCCAAAACATATAAATCCCACGAATCTAAAATCACTTCAGTTACC
TTGGATTAATCTCAGAAGTATTTTGCAACTACATCTCTAGATAGAAAGTGGATGTTATGG
GAATATAAAGATTTCTGA


>TTHERM_00700970(protein)
MSSDKQEERIYYGSLEEQERQRIIDEEKQKQERKQQQASQSAPNSSSDQQQSQQVQTGQL
KSLGGKQLKSLADKDKSQTNVQIEVLELSEHALEEKRRHDENMRKLELQKKASTMIVPTN
DKEVKYRLRQLGHPICYFGENNADRRERLKKVQAEYIMEHGDLPQFIKLEEKQKQNDENE
HFYYPGIKELKEIREEIATYSLLKSSRRVYKSKVGRMEEDPLVEEKKQISSLNRAMKFDV
CVSQFADSSIVLRGAFSPECDLLATAGGSGVSKIWNIPNSDLKCRLEGHLSKVHDIVWNP
ETGSMSHNSFGHLATGSSDTNIRLWTMDPAAELQKSIVLSGHEDRVNRLSFHQTGKYLFS
TSHDMTWRFWDIERQKEIYVQTGHTKGVYANALHPDGSLIFTGDLQGYGMIWDLRTGKGI
LPFSGYHVKGILAADFSENGFQFVTGSEDNTLRVFDIRRRACMHTLPGHLKLISDVKFQK
NGSNYFVSVSYDNTLKLWNAKDFSLAKTYKSHESKITSVTLDQSQKYFATTSLDRKWMLW
EYKDF