Identifiers and Description

Gene Model Identifier

TTHERM_00701150

Standard Name

GDP1 (Glycerophosphoryl Diester Phosphodiesterase 1)

Aliases

PreTt14912 | 109.m00130

Description

glycerophosphodiester phosphodiesterase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF03009 ) glycerophosphodiester phosphodiesterase family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16093.1 9.997093137033517e-262
Description: glycosyl transferase, group 1 family protein (771 aa)
Oxytricha Contig2747.0.g57 4.000521932330652e-52
Description: Glycerophosphoryl diester phosphodiesterase family
Stentor Coeruleus SteCoe_18378 4.248354255291589e-18
Description: None
DictyBase DDB_G0271374 0.000000000040005666873964816
Description: DDB_G0271374 on chromosome: 2 position 135005 to 136400
SGD YPL206C 0.00000000019994075865167896
Description: PGC1 Phosphatidyl Glycerol phospholipase C; regulates the phosphatidylglycerol (PG) content via a phospholipase C-type degradation mechanism; contains glycerophosphodiester phosphodiesterase motifs
WormBase WBGene00019612 0.0000000020002373268528243
Description: Putative glycerophosphocholine phosphodiesterase GPCPD1 homolog K10B3.6 status:Partially_confirmed UniProt:Q21407 protein_id:CCD64603.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00701150(coding)
ATGGCAGCTTTAAAAATTTTGTTAGTAGCCATCCTTTTGTGTTCTGGATGTCTTAGTATT
AGTGTAACAAATAATACTACTTGGGACTACACAGTAGCTAAAAATAGACCTTTGGTAATT
GCTCATAGAGGTTATTCTTCTCTTTTCCCAGAAAACACTCTTGAAGCTTTCAGAGCTGCA
ATCTATGCTGGTGCTGATTTCTTTGAGTTAGATGTCCAAGTTACCAAAGATAACGTTCTT
TTAGTTTCTCATGATGCAACTCTTTCTCGTGTTACTGATGTTGCTAATAGAACTGAATTC
AAAAATAAGAAATCAACTAAATTGATTGATGGATAAAATGTCACTGATTGGTTTATTTGT
GACTTCACCCTTGCTGAAGTAAAAACCCTCAAAATTAAATAGGTTTAAGTTTAAGGAAGA
AATCAAGATTTGAACACCTATTTTACTTTCCCAAGCTTAAGAGAAACCATAGAAATGCTT
ATATAATTCAACTAACAACATTAAGGTAAAAGAAATCTTGATAATAGAATTGCAGGAGTA
GTAATTGAATCTAAGGATAGAGATTTTTATCTTAATAATTATCACTTTGAGTAAGGAGCA
AAAATTGTTGATTTACTCAGAGAGTTTAATTTACACACTATGTACAATGCTTCTATTTAT
GCCCCTATTATATTGCACTCTTTTGATGCACCAACAGTCTAATTATGGCATAATATTACT
GACTTACCTAACAGTTAACTTGGAAGAATCAATTCACTTCCTTATTCTCTCCAACAAACT
AGTACATATGCCACTACAGTTGGTTTGGAAATTAGCTCATTCTTTAACAATACTTCCAAG
AAACCCACTGGAGTTGTAGACTAAGTTAAAGCTGCTGGTTTATAAATACACGGTTGGACT
TTCAGAGATGATCAATTGACCTGGGGTAATGACAGTATTGATTAATACGTTATTGCTTGC
CAAACTTTAAATATAACTGGTATTATTTCTGAATTCCCAGAAGCTGCTATCAGTGTCGCT
GTTATGATACGTAGATAAAATGAAAAGATAATAGCTTAAATTTGA


>TTHERM_00701150(gene)
ATGGCAGCTTTAAAAATTTTGTTAGTAGCCATCCTTTTGTGTTCTGGATGTCTTAGTATT
AGTGTAACAAATAATACTACTTGGGACTACACAGTAGCTAAAAATAGACCTTTGGTAATT
GCTCATAGAGGTTATTCTTCTCTTTTCCCAGAAAACACTCTTGAAGCTTTCAGAGCTGCA
ATCTATGCTGGTGCTGATTTCTTTGAGTTAGATGTCCAAGTTACCAAAGATAACGTTCTT
TTAGTTTCTCATGATGCAACTCTTTCTCGTGTTACTGATGTTGCTAATAGAACTGAATTC
AAAAATAAGAAATCAACTAAATTGATTGATGGATAAAATGTCACTGATTGGTTTATTTGT
GACTTCACCCTTGCTGAAGTAAAAACCCTCAAAATTAAATAGGTATAACCAAATTTCTTG
CTAAATAACTAAATAAACATCTAATTATATTTATAATTTTGTGAGGCATAACATAATTTT
AATCAATTTAAGTTTTAAATATCATTTTATCTGCTAGTAAAGAAATGAAAATGCACATTT
TTGCACTTTTTAAACATAAAAAACTAGCTATATTAAATTAGTTTTTGAATAAATAAGAAA
AAAATAATTGAAATAACAATCAAAAAATATTGTAATTTACTGATAATAAAATTGATTAAG
AAATAGAAAAATAAAGATTAAATGTGATTGTTTTCAATTTTTAAAGAATAACTAAGATAC
TTCAAACATTTGGGTTAAATTATATTTATCCACAGTAGACTAATTAGTGAAGCAAATTAA
AAAATTATATTTTCAAATGAAATGTTTGTTTGAAATAATAAAATAAAATAAATATTTACC
CTATTTCTCCCTTTTAAAACATGAGGATTTAATATAAAAATTTAGAATATTTATAAATCT
TAAAATTAATATTCAATTTAAATATTTCCATGAGAATAATCTATAAGCTTAAAGAATGAT
TGCAGTGATATTATAAAGTATAATAAATACCATAAAACCATTTAAGATTAATATCAAATA
TTAATCAAAGAATAAAATAGCTTACTTTTCTCTCTATCTTTCAGAGTTTATTTGTGACTT
CTTAAATTACAATACGATTTTTAGAAATTTTAATCAACAAACTCTTTTACTAATTAAATT
AAATTTATTTTTTTAAAGAAATTTTATTGCCTCTACATTATTTTAGCTATAATTTTATTC
CTATTATCTTCTAAAATTTTATTATTTTTGAAATATCAGGTTTAAGTTTAAGGAAGAAAT
CAAGATTTGAACACCTATTTTACTTTCCCAAGCTTAAGAGAAACCATAGAAATGCTTATA
TAATTCAACTAACAACATTAAGGTAAAAGAAATCTTGATAATAGAATTGCAGGAGTAGTA
ATTGAATCTAAGGATAGAGATTTTTATCTTAATAATTATCACTTTGAGTAAGGAGCAAAA
ATTGTTGATTTACTCAGAGAGTTTAATTTACACACTATGTACAATGCTTCTATTTATGCC
CCTATTATATTGCACTCTTTTGATGCACCAACAGTCTAATTATGGCATAATATTACTGAC
TTACCTAACAGTTAACTTGGAAGAATCAATTCACTTCCTTATTCTCTCCAACAAACTAGT
ACATATGCCACTACAGTTGGTTTGGAAATTAGCTCATTCTTTAACAATACTTCCAAGAAA
CCCACTGGAGTTGTAGACTAAGTTAAAGCTGCTGGTTTATAAATACACGGTTGGACTTTC
AGAGATGATCAATTGACCTGGGGTAATGACAGTATTGATTAATACGTTATTGCTTGCCAA
ACTTTAAATATAACTGGTATTATTTCTGAATTCCCAGAAGCTGCTATCAGTGTCGCTGTT
ATGATACGTAGATAAAATGAAAAGATAATAGCTTAAATTTGA


>TTHERM_00701150(protein)
MAALKILLVAILLCSGCLSISVTNNTTWDYTVAKNRPLVIAHRGYSSLFPENTLEAFRAA
IYAGADFFELDVQVTKDNVLLVSHDATLSRVTDVANRTEFKNKKSTKLIDGQNVTDWFIC
DFTLAEVKTLKIKQVQVQGRNQDLNTYFTFPSLRETIEMLIQFNQQHQGKRNLDNRIAGV
VIESKDRDFYLNNYHFEQGAKIVDLLREFNLHTMYNASIYAPIILHSFDAPTVQLWHNIT
DLPNSQLGRINSLPYSLQQTSTYATTVGLEISSFFNNTSKKPTGVVDQVKAAGLQIHGWT
FRDDQLTWGNDSIDQYVIACQTLNITGIISEFPEAAISVAVMIRRQNEKIIAQI