Identifiers and Description

Gene Model Identifier

TTHERM_00703320

Standard Name

MRNN10 (Membrane Occupation and Recognition Nexus protein N-terminal)

Aliases

PreTt20108 | 110.m00081

Description

MORN repeat protein putative

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_15322.1 9.997093137033517e-262
Description: hypothetical protein (3409 aa)
Stentor Coeruleus SteCoe_23198 6.305116760146989e-16
Description: None
Oxytricha Contig17235.0.g46 0.00000000007999955850159168
Description: GCC2 and GCC3
DictyBase DDB_G0278825 0.00020003864201578029
Description: DDB_G0278825 on chromosome: 3 position 1248051 to 1250768

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00703320(coding)
ATGAAAGAATAAGAAAGTGGGAATTTAGAAAAAAGAATCAAGCTCATTGAATATAGAAAT
GGTATATACTAAGGTATGATACACCCTAATGAGGATAGAACTAATTTAGGTATATACACA
TGGGATAGTGGTGAAGTTTATTTTGGAGAATGGAAGCATGATATGTTAGATGGAGAAGGT
ATTCTCTTCTTTCCATTTGGAGGTTTTATCCATGGATTCTTTATGAAAAATAAGCTAAAT
GGAGCTGCATTTTTCAAATTTTCAAATGGAGATATTTATGAAGGCTTCTGGAGAAATGGT
AAATTAGAAGGCAATTGTTACAAATATTTTTGTGACGAAGAGAGATGGATTCTCTCTGAT
TATAAGAATGGCGAATTCAAAAAAATAATTTCAAAAGGCGATGGTCAACCTCCTTCATAT
GTATTTAACTACATAACTTCAACTTCAGATATAGCAGTTAAGCACCAAGACGACACATTC
TAATAAGATGGTCTTAAAATAGAAGCTATTAATTTTAACGATGGAGGATAGTATTTAGGA
TTAATTAAAAATAGCATGCCAACAAGTTTAGGTATCTTTAAATATTCTGATGGCAAATAC
GACGTTGGATACTATAAAGATGGCAGTCTTGATGGATTAGGAAGATTGAATTTGCATAAT
GGAGATGTTTTTGATGGATTTTTATAGAAAGGATTATTCAATGGTATTGGTGTTTTCTTT
TAAAAATAAAGCTGCTCATGGATATATGGAAACTTTGAAAACAATAAATGTGTCAATATT
CTTAAAAAAGGATAGGGAGCTTTTCCAATTGAAATAATAGAAAAATTCAGATCTGAGAAT
CATAGAAAAGCTAAAAAATATATTGACAAGATTACTCCTTTAGACGTTTATTTTGCTCCT
ATGTACAATCACATCCCAATAGGTCCTGAAAAGCATAATTTTTACTTAGATTTAAGTATT
ACTAACCAAGCAAATCTTTCTAATAATGGTGGATCTTAATAAAAAATACCTGAGTAATTA
CCTATGAAAAAGGTTTTGCCTAAAGATCTCACTTCATCTGACTACCAATCACCTCCTTAG
AAAAGAAGTTAATCAAAAGGTAAAACTTAGTAAGTTCCTTTGAAAACTCCTTCTGTTTCA
TCATCATTAGTGAGTTCAGCAAATAGATAAGATAACTAAAACCTCAAAAAAGATAGATAA
TCAAGCAAATCAATAGGTAAATCACAAACTATGCAAGCTTAGTAATAAAACCCTAAAATA
TTCGTCTCTTAATCATCATAGGGATAAGATTTAAAGTAGTCATAATAGCAATAACAAGAT
AAAAAGTCAAATTCTAAGAAAGAAGTTCCTAAAAAATAAAATTTAGTTTCTCCCCCTCCA
AGATAAGGTAGATTAGGTGCTCAGTAATAATAGTCAAATCAATCTTCAGCCAAAAAAAGC
AACTTAAAAAAAGCTAAACAAAATTCCTCTAACTCTAACAAGCAAAGGTCCAGATAGTCA
TCTGTCTCAAAAATTTAAAACGAGAAATAAGAGATAGATTAACAAAGTATTCATGACTAT
GACAATATGGTGAAGTTAATGAGCTAGCATTAAGAAGGTTAAATTAATATATCATAATCT
TAAGGGTAGAATATAAATTTTGATGAAGTATTTAATACTGAAAGTAGCCCTAAATCATAG
TAGATTTAATAAAGAGAGTTTAAATAATAAAAGAGTTTAGCATAAATTATAGGTAGTGAA
GAGATTGATGAACCAAAATAGTTTCCCTACTAAAAATCTAAATCAATGGCAGTATTTAAT
TCTAAGAAATCATCCTAAGCTTCTTCTGTCAAGCAGTAAAACATTCATGAAATTGGAAAT
GTGTCTAAAATTTCAGGCATAGGATAAAGTGACACTTCAGGAGTTTACAAAGACAATAAT
AGAAGTGGAGTTGCTAATTAGGGTGATTTTACAGGGATTATTAAACCTAATATATTCGGC
AAAAAGTCTTCAAGTGCTCCTAAATAAGCTAAATAAGTCTAAAATAAGCAAAAAGATGAT
AAATCAGGAACAAACAATGAGCAAAGCGATTCTGACTCAAGCTTTAGTTCATATAGCAGT
GATAGAGTTGTTAGAAAATAGACAGCTCCTCCTACATCTGGTAGAAAATAGATTGCTATA
ATAAAGGAAGAAGAGAGAATGAGATCATACTCTGGTACTCCTGCAAATAGATTTGTTGAA
AGCTATACAAATAGAGATTATTTTGGCTCTAGAGATGATCAAGTTAGTTCTGGAGGTAAA
TCGTATAAAAATGAATAGGATTTAAGAGAGAGCTTGGAAGAAGAAGAAAATAAATAGTTT
TTGGAAGCAGAAAGATTGTCAAAAGAAGAAGTTGAGAGTAAAATTGAGAGAGCTCATGAT
AAGAAAAATAACGATTAAGATGAAGAATATGGGCATATAAAAATTAAAGATATAATAAAT
GTTGATGACTAGTCAAATTAAAATAGCCATGTAGGTGAGCAATCAAGAAAGGGTGCAGAT
TCAACACCACACAATTAGTTTATCACTATTCAAAATTAAAAAAATAAGCCTATTCAAATT
TAAAAAAATGAATAAATTATTTCTGATAAGCAAGGATTTAACCAAATTGAAAAAGATAAT
GACACTCCAATAAGCAAAAAATTAGAGGATTTATAACACCTAGCATAAAATAGAGACATT
CAAAAAATGTATTAATCAAAAAAGAGCAACTCAATTTTAGAATTAGAAAATATCCGAAAC
GAAATAGCCAACTATGAGCAAATAGCATAATAAGATTTACCATAAAGAAGCAAAAAATCA
AAGTAAGGGAAAAAAGACACATCTAGAGAAACTTCACATCCTCGTACTCCATAATCTATA
GTTACTCCTAAACATCTACCAAGCTAATCCCCAAACTTCTAATAAAGCCCCATTCTAACT
AGTCTACCTAATCCTAAAATATAATATTAATAAGAAGAGGAGCTAGATCTTGAAGAATCA
GAACATGTTTTAGACTCAATAAAGTAGATAAAGCAGTAAATGATTCATCAATTGAATCAT
TTAGAAAACAAGCAAAGAGAAGTTACCACTCCTGCAGCATCAAACTTTAAATATAATATA
GCCCCTAATTTTAATATTCCGAATGATGAAAACCACATCTTAAAAGATGATTCCTTAAAC
TAAGATATATCCCCTCAAAATCCTATCGAAAATTTTGAATCTCCTTTCAAAAAAGACAGT
CTAGTTTATGAAAGAGAAAATAGTCAGGGCAGAGGTAGAAGCACCAATCATAGCAGAGTA
GAAAACAGCAGAAGTTATAAATATTATACTGAGGAGGAGGCTAACCAGATAGCCTAAAAG
ATTGAACAAAATCTGGCATTCTAAGGAGATTAAACCAATAAACAAACAAAAGTAAGTGAA
AATGAGAGAGGAGAAAACTTTATAAATGAAGAAAGTGTGCAAGTTGGTGACATTAATGAG
GAGATTCAAATCGATGATCAAAGAGCCGGTCGTGAAGATAGAGTTGTAAGATCAAAGCTA
GAAAGAGATTCAGAAATGCATGATATTTAAGAGAAATAAATATAAGATTCTATTTTATAA
GCAGAAAAACTCAATTAAATGCTTGATGGCAACACAAATTAACAAAGATTAAACTAAATT
CAATCTTATCAGAGATAATAAAACGAATAAATGAGACTTAGCGCATAAGGATAGTAAGAA
TTTTTAGCATCTTAGAAAATAGATGAGTAAAACTAAAATCAAAAAACTCAAGCAGCATAA
ATTAATTAATAAAATTAATAAGGTTAATCTTAATAAAACATAAAAAACCATTCAGTAGCT
GCATCACCAAATAGTCAATCTCCAATAAATTAAATTCAACAAAGATCAATCAGCCCCCAA
AGTAATTCCTTGAATTCAAGTCAAATTACAGCTGGCTAAGTTATTTAAGTTGTCAAAGAA
ATACTCCCCCCAACTTAACAAACTACTATTTATTAGAAAAAGCTAAGTGATAATGCAATT
TAATCTACTGTTGTTACTAAAACAATACAGCCAATCGTCACAACCAAAATTATTTCACCC
GTTCGTTCTCGTCCGTCAAGCTAATCTAACTCTCCTTTAACTAAATAAAATTAAAATGCC
CTATAAAATAACAGCCCTGGCAAATTTAATAGCCAGATTATTTCACAGTAATTACTACCC
TAACAAGTACTAGGATAATTACAGTCTATAATAGGAGGAGGAAATTCTAATCAGTAAGGT
TAACAACCTGCAAATTAAAATAAAATTTATTCTGATAGGACCCAAAATAGAATAGTGTAA
GCCGTTAATTAATAATGGAAGCAAAAAAATCCTGAATTATTCTAAAATATAACACCAATG
GAGTTTTATTAGAGTATTGTTCAAAGATAAAATATACTAAAGGACTTAAGTCCTGAACAA
CTTGAATAGCTTGAATAAGACATAAAAACTTTGAAGCAGATGAACGTAGCTGATGACCTT
TAGATAATTCTAGAATAAAACATCTCTAATGTTACTTCACCTTTGAATGCATCTAATAAC
ACAGATATTAAACATTACACATTTTAAGGAGATGATATTACTCCCTCTTTGCAAAGAAGA
AAATAAGAAGAAGAATTAGCAGCTACTGCTGCAAAAACTGCATTAGATGTTACCGCAGCT
GCTGAAAAGGCTAGAAAGGAGTATGAAATCTAGCAGCAACATCTGCAAAATCAATTAGCT
TTAACTCAAAATCACACACTCTTAACTTAATAATAATAGAAAGAAATATAAGAACTTAAA
AAGTAGTAAGAAGAATTTATTAAGCAACAACTTGAAATACAAAAATAATAGGCTGAGTAT
TTAGAAAAGCTTTAAAAGTAGCAAGCATTAATCATTTAATAAGGAGAAGAATAGCGTAAA
CGCCATGAAGAAGAAAAGACTCGCTAGCTTAAGGAAATAGAGGCTCTTGAGAAATAAAAA
AACTAAAGAATCATAGAAGAAGAAGAGAGATTGAAGTAACTACGTGATATGCAAGAAATG
GTGCGCCAATAGATAGAAGATGATTTACAACGCAAAAAATTAGAAGATGAAGAGCACAGA
AAGCGCTAGAAAGCTCTCTTTGATAAAGAATAAGAAATTCTAGATAGATTGCAAGATGAA
TAGGTAAAACTGTCTTAGCTTTAATAAGAATAGGCCAGGCTTTAGGCTTAAGAGTTAGAA
AATAAAAAAGTAAGAGATATGTAATTAAAAATGGAAGAAGAGCTAAGAAAGAAGGAGGAA
GAAAAATTGGAATAATTAAAGATATAGTCTGCTTCGCTAAATGAAGAGATAAAGAATAAC
CAAAGCAGGAGTGAAGAAGAAAGAGTAAAAATGCATTAACTGTAGTTAAAATATGCAGAA
GATCAAAGAAAATAATAGGAAATCTTAGATGAATTAAATTCATAAAAATTACTTAAAGAA
AATTCACAACGTTAACAAGATATTATTTAATAATAAGACATACTTGAATAGTAGAAATAA
ATTAATGAGTAACAATATGCTTTGTAGCAGGAATAGCTTAGAATTCAACGTGAGCGTGAA
GAGTTAGAGATTTTACAAAAATAGAGAAACGAAGAATCTTTCATTAACGAATAGTAAAGA
CTTGCTATTTTACAATCAAAGGAATAGGAACTAGAATAATAGATTCGCTAATAAAATTAG
TCTTTCTTAGCCTAATAAGAAGAATTATAACGCTAAAAGTAATAACTAGAGAGTTAAAAG
CTCGATCTCATTTTAGAATAAGACCGTTTAAAGAAGAAGTCAGATCTCGATGATGCAAAG
TTGAAGGATGTTGAAAAAAATCTATAGGAGTAATTGAGTAAAATAGAGAATGAAAAAGAC
TAGTAAATATAAAGAGATTAAGAAATATAAGCAAGAGTGAGACAAGAATCTATAAATGCA
CAATAGGAAGAGCTTCAGCGTTAAAAATAATAAATTGAATTCTAAAAATAAGATCTGATT
ATAGAGTAAGAGCGCCTCCGTTAAAAATTAAAAGAAGAAGAAGAAAAGAGATTAGAAGCT
GAGCGTATTTTATAGGAAACGATTTTGAAGAAGTAGTTAGAAGATTCAGCAACTGTTTAA
TTAAAAAATTAAGTTGATTTAGAAAAATTAGAATAATAGAAGTAAATTGAAATTAAACTT
CGTGAGCAGTAAGAGTAAATTAAGAGAGAGAAAGAACAATTAGAGAGAGAGCGCTAGTAA
TAGGAATATGAAAAGCAAAAGCAGCATGAAAAGGAGAAAGAGGTTATTGAGTTACAGAAT
GCCTTGAAGTAAAAGTAACTATTTTTAGAATAGTAACAGCGAGAAACACAACTTAAATTA
GAATAGCAGTTTAAAGAATAGCAAGAATAGATGCTTAGAGAAAAAACCGAAATAGAAAAA
TAAAAAATAATTCAGGAACAATAAAAATAAAAGCAAATTGAACTTGAACAAGCAGCAAAA
TAATAAGAAGAACGTTTAAAATAGTAAAAACTATTATTAGAACTAGAACAAGAATAAAAA
AAAAGAGATGCTGAATAACAGCTTCGTTTCCAACAAGAGCAAATACAAAAAGAAAAAGAA
GAAGTCTAAAAGTAAAAAGAACTTCTTGCTTAAATGGAAAGAGAGAAAATTGCTATGGAG
TTAGCTCGCTAGCAAAAAGAACAAGAAGAGCGTAGAAAGATAGAAGAATAAGAAAAAAGA
GATAATTATTTTAAAAAAGTAGATGTATTCACTAAGGAAATAGAATCTAGAAGAGGTTAC
ATATCACCTCGTTAATCTTCTCTTGATATTCCTCCTTCAACATAAGTAATCTTAAATAAT
CCCAGCACTTTAGAAAATAAAGATAGTTCTAATCTTCTTTTCAAGACAAACCAAAGCGCA
AGCAGTTCACCTATTAATACAAATCGCTCAGATATCGAAACTATGATTAGGGAATCCCAA
GCTCGCTTAAAGCAATCAATAGCCTAATCTGTCTAGTAAGTTGATAAGATAGGATAAATT
GTAAATCCTTATTAAGATATTTCAATTAAGAACTCAGAAAGTGCAGAGGCTGTGAAAAGA
TCGACACATTAACCAACCACTACATAATATCCTATAACAAATACTAATTTGTAATAAGAA
TCTCAGCCCTAAAAAGACATTCTTGAGAGTTACTCTCAGTAAAAAAATATCGATTTATTT
AACCAAATTGACAAAATAGTGCGTTCAGCTTCTCAATCTGCCTCCACTTCACCTATAGGC
ACTAACAACAATAAAAATAACTTTGGAGATTCTCTAGATAGACTTAACAGGTTCACTGGC
TCATAAGTTACTTAGTAAACTCCATCAACAGAAATAAAGAATTAGGCTTAGACTGATCTA
GATTTATAAAATAGAGTAAATCAAATATAGAACTAATCTAAATCTAGTGAATCAGTAATA
TCTGCGTTACCTACTCCAATAAATTCTGTATAACCAATATAAACAAAAACTACTCAAGAA
TAAAAGAATAGTAGCTACATACCAACATCAGATGATTTTAGAGGTAGTTTATTGTTAAAT
AACTTAGAAAAATCTACTCAAAACCAAATAAGAAGCGATCTATTTAAAAGCATTGAAGGG
GTAAATTCAATAGTCTCCCCTAATTCTAAAAACCAAAATAAATCAAGCTTTGGAGATTTT
AGTAGCTAGAACTAATAGCAAAATAAGGTTTAAGGTGTAAGTGACTACACATCCTACCAA
TACTAATCTTAAGTAAGCAGTACTCCAAGCAATCCTATTTTCCAAAAAATAGAACCTTCT
GCTTTGACTAATAATAACAGTGCTAATAAATAGCCTTTGGAGAAAAATAATTAATACTAA
TTACCATCTAGTGTTACATTTAGTGCTCTTCCTTCTGTTACTTCTTATATGCCATTAACC
CAAAGTATTTAATAAAATACTGTATAGGGTGAAGGATTACTCAATCGTTTAGATAACAAA
AACGATAATAAAAAACAGAATGCAAATTCTTAATAGAATCCAGTTAGTGAGCAAATAGTA
GACAGTATTTTGAGTGAACCTTTTGCTCCTTAGCCAACTGCTAATTTTGATACCCGCTCT
TCAATCAGCTCAATCAAAAGAGAGCCTATTAGTTACCCTGGAAACACATATACTGCATCA
GTTAGCGGAATTCCAATTTAACCCTATTCATCTTGGACTAATCCAGTAAGCTTGAACTCG
AGTGGAGGAACAGCTGCATTTTTGGGCTTACCAGTTTCATAGTAAAACAAAAACTCTCAG
CCATAAACTAATTAAAATAGTGCCAACTAAACCTTGTTTGTTTCTTTTGGTAATGAAAAG
ATTTTGGGAAGTAATCCATTAAAATCTTCAGTTCCTGGTACTAATAAGGATTAAATTTTG
TCAGGACTACCAACATACACACCATCAATATTGATGAGCACTTCTTTTAGTAAATTACCA
AACAATTCGTTCAACTAAGGAGAAAAAGATAAACAATCATCTGTAAGATCATCAGGAGCA
GTCTCTAACGAGTATAAGTAAGCCCTCTATTAAAAACAAAATATCATTCCAGCAAGCGAT
TAACTTACTGCTGGTGCCCTTAAAAGCAATCCTACTACTTATGTTTCTAATTAAAAACCT
TCAATAAATATTGGTAATATTAACCAAGGTTCTTACACTACTTCTTCTTTAACTGGAGTC
GATGCTTACATTCCACTTACTACTGGTGCTTCTGCTCTGATTTCGCCCAGAACTCAAGAA
TTAAATTCCTACAAGATCACCACTTCAGCCCTAGTCCCAAGTAGCAGATAAGTTGTAATT
GGTAATCCCAGTAGTATTGAAACTTCAGATTAGAAATATAATAAACGCTTATCAATAACG
AGTGATGTCATCGAAGAAGATCCAAAGCGCAGCAACAACTAAGATAGTGCTTCAAAGCTC
GGAAACAATACGCTAAATTCTTCTGCAGGCTTTATCGGTTACAAGAAAAAAATAAAAATA
CAGCCATCTCCATAGGTGATAAAGGAAACACATCTTCCTGTAATTCGCAGTAATTCCAAT
AATAATAGCAAAGATTCATCATTTTTCCTTAATAACAATTCTTTTTCATAAAATAATCCA
AAAATACCAAACCCTACTTCTGTAGCTGCAGGTAATAATAACTATATATTGAATAATTCT
TTCAGCAACTTAAATAACTCATTTTCTGGTGCACCTAAAGACACAATTACAGCTGGAACA
AATTTCAATAATTTTTTGAATAGCTCATTCACTGATGAGAAATCTAAATAACAAAGAAAT
ACTCTTGACAAACTTAATAAATAAGGCTAATTAAATTAGGTAAATGGTTTAATTAAGAGT
GGTGAATCATAATAATCATAATAAAAAATTTCTTAATTCAACTCTCCTTAATCTTAAAAG
ATAGCTAGCCAACTTGCCTCTACTTAGAATCTGAATCGTTTTGCATCACCTTAATCAGAT
ACTTCGAGAGGATCTGTTTCTTTAACAAAAAAAACTAATGTCACTGTGGTGCATACTCCA
GGAACAGAAGGTGCTATATCCTTAGTTAGAGCCATCTAAAATACTTACACTTATAACGAA
CCTACTCATAACGATGATAGTTTCCACAATAGCAGTTTTAACAATTTGAACAAATCACTT
CTCGATTCCCAGGCCTCACAATATTTGGTATACATTTGA


>TTHERM_00703320(gene)
ATGAAAGAATAAGAAAGTGGGAATTTAGAAAAAAGAATCAAGCTCATTGAATATAGAAAT
GGTATATACTAAGGTATGATACACCCTAATGAGGATAGAACTAATTTAGGTATATACACA
TGGGATAGTGGTGAAGTTTATTTTGGAGAATGGAAGCATGATATGTTAGATGGAGAAGGT
ATTCTCTTCTTTCCATTTGGAGGTTTTATCCATGGATTCTTTATGAAAAATAAGCTAAAT
GGAGCTGCATTTTTCAAATTTTCAAATGGAGATATTTATGAAGGCTTCTGGAGAAATGGT
AAATTAGAAGGCAATTGTTACAAATATTTTTGTGACGAAGAGAGATGGATTCTCTCTGAT
TATAAGAATGGCGAATTCAAAAAAATAATTTCAAAAGGCGATGGTCAACCTCCTTCATGT
AAAATAATAATTTTAAGATTTTAAGATTATAAAATAAGCTGCCAAGATGCATATCTATCA
AAAAATATTAGAATACAATATTTATAAATTTTAAGATTAGTATAGCATTTATTTTTATAA
GTTTGTAGCAGTCAGCTACAACAACTAGGACTAAAAATATCTAGTTTTTCAAATTTTAAT
TAGCAATAAATAAAAAATAAGCTACTAATTTGAATGAAAAATAAAAATATATTTTAAAAA
TAGATGTATTTAACTACATAACTTCAACTTCAGATATAGCAGTTAAGCACCAAGACGACA
CATTCTAATAAGATGGTCTTAAAATAGAAGCTATTAATTTTAACGATGGAGGATAGTATT
TAGGATTAATTAAAAATAGCATGCCAACAAGTTTAGGTATCTTTAAATATTCTGATGGCA
AATACGACGTTGGATACTATAAAGATGGCAGTCTTGATGGATTAGGAAGATTGAATTTGC
ATAATGGAGATGTTTTTGATGGATTTTTATAGAAAGGATTATTCAATGGTATTGGTGTTT
TCTTTTAAAAATAAAGCTGCTCATGGATATATGGAAACTTTGAAAACAATAAATGTGTCA
ATATTCTTAAAAAAGGATAGGGAGCTTTTCCAATTGAAATAATAGGTAAATAGATTAAAT
TGTGTTTAGTTTACTTAATTTTATTTAAATTGTTTAACAGAAAAATTCAGATCTGAGAAT
CATAGAAAAGCTAAAAAATATATTGACAAGATTACTCCTTTAGACGTTTATTTTGCTCCT
ATGTACAATCACATCCCAATAGGTCCTGAAAAGCATAATTTTTACTTAGATTTAAGTATT
ACTAACCAAGCAAATCTTTCTAATAATGGTGGATCTTAATAAAAAATACCTGAGTAATTA
CCTATGAAAAAGGTTTTGCCTAAAGATCTCACTTCATCTGACTACCAATCACCTCCTTAG
AAAAGAAGTTAATCAAAAGGTAAAACTTAGTAAGTTCCTTTGAAAACTCCTTCTGTTTCA
TCATCATTAGTGAGTTCAGCAAATAGATAAGATAACTAAAACCTCAAAAAAGATAGATAA
TCAAGCAAATCAATAGGTAAATCACAAACTATGCAAGCTTAGTAATAAAACCCTAAAATA
TTCGTCTCTTAATCATCATAGGGATAAGATTTAAAGTAGTCATAATAGCAATAACAAGAT
AAAAAGTCAAATTCTAAGAAAGAAGTTCCTAAAAAATAAAATTTAGTTTCTCCCCCTCCA
AGATAAGGTAGATTAGGTGCTCAGTAATAATAGTCAAATCAATCTTCAGCCAAAAAAAGC
AACTTAAAAAAAGCTAAACAAAATTCCTCTAACTCTAACAAGCAAAGGTCCAGATAGTCA
TCTGTCTCAAAAATTTAAAACGAGAAATAAGTAAAAAAAATTAATAATTTATTTAAAATT
AAAATTAAATTTTAGAGTTATTTAAAATAAATAAAAAAAGTATTTTAGTAATTAATTGTA
AAATTTAGAATAAAAGCCACTTTTTCGAAACCTTAATTCCAAAATTAATTTTAGTTATTA
TAAGGAAATTCATTTTATTCTTATTAAGATTAAAGCTATTTTAAGCAAAAAATAGTTTAA
ACTAAAACGATTGATAAAAAATTTGTTTAGCATTTTTATGAATTTTTGCAAAATATTTTT
ATATAAAAGGAGATAGATTAACAAAGTATTCATGACTATGACAATATGGTGAAGTTAATG
AGCTAGCATTAAGAAGGTTAAATTAATATATCATAATCTTAAGGGTAGAATATAAATTTT
GATGAAGTATTTAATACTGAAAGTAGCCCTAAATCATAGTAGATTTAATAAAGAGAGTTT
AAATAATAAAAGAGTTTAGCATAAATTATAGGTAGTGAAGAGATTGATGAACCAAAATAG
TTTCCCTACTAAAAATCTAAATCAATGGCAGTATTTAATTCTAAGAAATCATCCTAAGCT
TCTTCTGTCAAGCAGTAAAACATTCATGAAATTGGAAATGTGTCTAAAATTTCAGGCATA
GGATAAAGTGACACTTCAGGAGTTTACAAAGACAATAATAGAAGTGGAGTTGCTAATTAG
GGTGATTTTACAGGGATTATTAAACCTAATATATTCGGCAAAAAGTCTTCAAGTGCTCCT
AAATAAGCTAAATAAGTCTAAAATAAGCAAAAAGATGATAAATCAGGAACAAACAATGAG
CAAAGCGATTCTGACTCAAGCTTTAGTTCATATAGCAGTGATAGAGTTGTTAGAAAATAG
ACAGCTCCTCCTACATCTGGTAGAAAATAGATTGCTATAATAAAGGAAGAAGAGAGAATG
AGATCATACTCTGGTACTCCTGCAAATAGATTTGTTGAAAGCTAGTAAATATTTTTTATT
TATTTTACTTAAATTCTAAATTAATTTTTTGCTTTTTAGAAAAAGTACAAATAGAGATTA
TTTTGGCTCTAGAGATGATCAAGTTAGTTCTGGAGGTAAATCGTATAAAAATGAATAGGA
TTTAAGAGAGAGCTTGGAAGAAGAAGAAAATAAATAGTTTTTGGAAGCAGAAAGATTGTC
AAAAGAAGAAGTTGAGAGTAAAATTGAGAGAGCTCATGATAAGAAAAATAACGATTAAGA
TGAAGAATATGGGCATATAAAAATTAAAGATATAATAAATGTTGATGACTAGTCAAATTA
AAATAGCCATGTAGGTGAGCAATCAAGAAAGGGTGCAGATTCAACACCACACAATTAGTT
TATCACTATTCAAAATTAAAAAAATAAGCCTATTCAAATTTAAAAAAATGAATAAATTAT
TTCTGATAAGCAAGGATTTAACCAAATTGAAAAAGATAATGACACTCCAATAAGCAAAAA
ATTAGAGGATTTATAACACCTAGCATAAAATAGAGACATTCAAAAAATGTATTAATCAAA
AAAGAGCAACTCAATTTTAGAATTAGAAAATATCCGAAACGAAATAGCCAACTATGAGCA
AATAGCATAATAAGATTTACCATAAAGAAGCAAAAAATCAAAGTAAGGGAAAAAAGACAC
ATCTAGAGAAACTTCACATCCTCGTACTCCATAATCTATAGTTACTCCTAAACATCTACC
AAGCTAATCCCCAAACTTCTAATAAAGCCCCATTCTAACTAGTCTACCTAATCCTAAAAT
ATAATATTAATAAGAAGAGGAGCTAGATCTTGAAGAATCAGAACATGTTTTAGACTCAAT
AAAGTAGATAAAGCAGTAAATGATTCATCAATTGAATCATTTAGAAAACAAGCAAAGAGA
AGTTACCACTCCTGCAGCATCAAACTTTAAAGTAAATAATCCAACCATTTTAAAAATTTA
ATAAAATTGTTCAAATATATAAAATCTAATTATTTTTTATAAAGTATAATATAGCCCCTA
ATTTTAATATTCCGAATGATGAAAACCACATCTTAAAAGATGATTCCTTAAACTAAGATA
TATCCCCTCAAAATCCTATCGAAAATTTTGAATCTCCTTTCAAAAAAGACAGTCTAGTTT
ATGAAAGAGGTATTTAAGAAAAAATTTTTTAAAATTATTGTTATTATAGGTTATATCATA
ATTTAAACAAAATATATCTTTATTTATATTAACAAAGAAAATAGTCAGGGCAGAGGTAGA
AGCACCAATCATAGCAGAGTAGAAAACAGCAGAAGTTATAAATATTATACTGAGGAGGAG
GCTAACCAGATAGCCTAAAAGATTGAACAAAATCTGGCATTCTAAGGAGATTAAACCAAT
AAACAAACAAAAGTAAGTGAAAATGAGAGAGGAGAAAACTTTATAAATGAAGAAAGTGTG
CAAGTTGGTGACATTAATGAGGAGATTCAAATCGATGATCAAAGAGCCGGTCGTGAAGAT
AGAGTTGTAAGATCAAAGCTAGAAAGAGATTCAGAAATGCATGATATTTAAGAGAAATAA
ATATAAGATTCTATTTTATAAGCAGAAAAACTCAATTAAATGCTTGATGGCAACACAAAT
TAACAAAGATTAAACTAAATTCAATCTTATCAGAGATAATAAAACGAATAAATGAGACTT
AGCGCATAAGGATAGTAAGAATTTTTAGCATCTTAGAAAATAGATGAGTAAAACTAAAAT
CAAAAAACTCAAGCAGCATAAATTAATTAATAAAATTAATAAGGTTAATCTTAATAAAAC
ATAAAAAACCATTCAGTAGCTGCATCACCAAATAGTCAATCTCCAATAAATTAAATTCAA
CAAAGATCAATCAGCCCCCAAAGTAATTCCTTGAATTCAAGTCAAATTACAGCTGGCTAA
GTTATTTAAGTTGTCAAAGAAATACTCCCCCCAACTTAACAAACTACTATTTATTAGAAA
AAGCTAAGTGATAATGCAATTTAATCTACTGTTGTTACTAAAACAATACAGCCAATCGTC
ACAACCAAAATTATTTCACCCGTTCGTTCTCGTCCGTCAAGCTAATCTAACTCTCCTTTA
ACTAAATAAAATTAAAATGCCCTATAAAATAACAGCCCTGGCAAATTTAATAGCCAGATT
ATTTCACAGTAATTACTACCCTAACAAGTACTAGGATAATTACAGTCTATAATAGGAGGA
GGAAATTCTAATCAGTAAGGTTAACAACCTGCAAATTAAAATAAAATTTATTCTGATAGG
ACCCAAAATAGAATAGTGTAAGCCGTTAATTAATAATGGAAGCAAAAAAATCCTGAATTA
TTCTAAAATATAACACCAATGGAGTTTTATTAGAGTATTGTTCAAAGATAAAATATACTA
AAGGACTTAAGTCCTGAACAACTTGAATAGCTTGAATAAGACATAAAAACTTTGAAGCAG
ATGAACGTAGCTGATGACCTTTAGATAATTCTAGAATAAAACATCTCTAATGTTACTTCA
CCTTTGAATGCATCTAATGTAAACTTATAAATTATTGAAAAATTTGAATTTTCACATCGA
TCATGCATGATCTTTATTTTACCCATTAAAACATGACTTTAGCTCATATTTGCTATTTAA
ATTCTTATTTTGAATAATTTTTTTGCATTATTTCATCATTTTTTGTATATTTTAATTGTA
CTTAAAATATTTTTAAGTATTTTCTTCTAAAATTCATCATTGATTTTATTTATATTGAAT
AATAAAAGAACACAGATATTAAACATTACACATTTTAAGGAGATGATATTACTCCCTCTT
TGCAAAGAAGAAAATAAGAAGAAGAATTAGCAGCTACTGCTGCAAAAACTGCATTAGATG
TTACCGCAGCTGCTGAAAAGGCTAGAAAGGAGTATGAAATCTAGCAGCAACATCTGCAAA
ATCAATTAGCTTTAACTCAAAATCACACACTCTTAACTTAATAATAATAGAAAGAAATAT
AAGAACTTAAAAAGTAGTAAGAAGAATTTATTAAGCAACAACTTGAAATACAAAAATAAT
AGGCTGAGTATTTAGAAAAGCTTTAAAAGTAGCAAGCATTAATCATTTAATAAGGAGAAG
AATAGCGTAAACGCCATGAAGAAGAAAAGACTCGCTAGCTTAAGGAAATAGAGGCTCTTG
AGAAATAAAAAAACTAAAGAATCATAGAAGAAGAAGAGAGATTGAAGTAACTACGTGATA
TGCAAGAAATGGTGCGCCAATAGATAGAAGATGATTTACAACGCAAAAAATTAGAAGATG
AAGAGCACAGAAAGCGCTAGAAAGCTCTCTTTGATAAAGAATAAGAAATTCTAGATAGAT
TGCAAGATGAATAGGTAAAACTGTCTTAGCTTTAATAAGAATAGGCCAGGCTTTAGGCTT
AAGAGTTAGAAAATAAAAAAGTAAGAGATATGTAATTAAAAATGGAAGAAGAGCTAAGAA
AGAAGGAGGAAGAAAAATTGGAATAATTAAAGATATAGTCTGCTTCGCTAAATGAAGAGA
TAAAGAATAACCAAAGCAGGAGTGAAGAAGAAAGAGTAAAAATGCATTAACTGTAGTTAA
AATATGCAGAAGATCAAAGAAAATAATAGGAAATCTTAGATGAATTAAATTCATAAAAAT
TACTTAAAGAAAATTCACAACGTTAACAAGATATTATTTAATAATAAGACATACTTGAAT
AGTAGAAATAAATTAATGAGTAACAATATGCTTTGTAGCAGGAATAGCTTAGAATTCAAC
GTGAGCGTGAAGAGTTAGAGATTTTACAAAAATAGAGAAACGAAGAATCTTTCATTAACG
AATAGTAAAGACTTGCTATTTTACAATCAAAGGAATAGGAACTAGAATAATAGATTCGCT
AATAAAATTAGTCTTTCTTAGCCTAATAAGAAGAATTATAACGCTAAAAGTAATAACTAG
AGAGTTAAAAGCTCGATCTCATTTTAGAATAAGACCGTTTAAAGAAGAAGTCAGATCTCG
ATGATGCAAAGTTGAAGGATGTTGAAAAAAATCTATAGGAGTAATTGAGTAAAATAGAGA
ATGAAAAAGACTAGTAAATATAAAGAGATTAAGAAATATAAGCAAGAGTGAGACAAGAAT
CTATAAATGCACAATAGGAAGAGCTTCAGCGTTAAAAATAATAAATTGAATTCTAAAAAT
AAGATCTGATTATAGAGTAAGAGCGCCTCCGTTAAAAATTAAAAGAAGAAGAAGAAAAGA
GATTAGAAGCTGAGCGTATTTTATAGGAAACGATTTTGAAGAAGTAGTTAGAAGATTCAG
CAACTGTTTAATTAAAAAATTAAGTTGATTTAGAAAAATTAGAATAATAGAAGTAAATTG
AAATTAAACTTCGTGAGCAGTAAGAGTAAATTAAGAGAGAGAAAGAACAATTAGAGAGAG
AGCGCTAGTAATAGGAATATGAAAAGCAAAAGCAGCATGAAAAGGAGAAAGAGGTTATTG
AGTTACAGAATGCCTTGAAGTAAAAGTAACTATTTTTAGAATAGTAACAGCGAGAAACAC
AACTTAAATTAGAATAGCAGTTTAAAGAATAGCAAGAATAGATGCTTAGAGAAAAAACCG
AAATAGAAAAATAAAAAATAATTCAGGAACAATAAAAATAAAAGCAAATTGAACTTGAAC
AAGCAGCAAAATAATAAGAAGAACGTTTAAAATAGTAAAAACTATTATTAGAACTAGAAC
AAGAATAAAAAAAAAGAGATGCTGAATAACAGCTTCGTTTCCAACAAGAGCAAATACAAA
AAGAAAAAGAAGAAGTCTAAAAGTAAAAAGAACTTCTTGCTTAAATGGAAAGAGAGAAAA
TTGCTATGGAGTTAGCTCGCTAGCAAAAAGAACAAGAAGAGCGTAGAAAGATAGAAGAAT
AAGAAAAAAGAGATAATTATTTTAAAAAAGTAGATGTATTCACTAAGGAAATAGAATCTA
GAAGAGGTTACATATCACCTCGTTAATCTTCTCTTGATATTCCTCCTTCAACATAAGTAA
TCTTAAATAATCCCAGCACTTTAGAAAATAAAGATAGTTCTAATCTTCTTTTCAAGACAA
ACCAAAGCGCAAGCAGTTCACCTATTAATACAAATCGCTCAGATATCGAAACTATGATTA
GGGAATCCCAAGCTCGCTTAAAGCAATCAATAGCCTAATCTGTCTAGTAAGTTGATAAGA
TAGGATAAATTGTAAATCCTTATTAAGATATTTCAATTAAGAACTCAGAAAGTGCAGAGG
CTGTGAAAAGATCGACACATTAACCAACCACTACATAATATCCTATAACAAATACTAATT
TGTAATAAGAATCTCAGCCCTAAAAAGACATTCTTGAGAGTTACTCTCAGTAAAAAAATA
TCGATTTATTTAACCAAATTGACAAAATAGTGCGTTCAGCTTCTCAATCTGCCTCCACTT
CACCTATAGGCACTAACAACAGTAAATATTATTTGAATTTATTAAAACTTCTTCTAATTC
CAATTCCATTTCTTCAATATTATTTTGAATTTTGTAAAAAAAAATAATTTTGTTAAACAA
TAAAATAAAAAAATTTTGAAAATTTCTCAAATAAGAATTTTATTGATTGGATGTTTGAAC
TAATTTAAAAAACATTTACCATTTTTATTATTTTAATTACTTATTAATTAATTTGGAAGA
ATTTAATAAATCAAAATTTAAATTGTGGACATGATTCACATAGAAATGAAAATTTTTAAT
TTTAAATATTACACTCAATTACTTTAAAAAATTAAAATATTATTTTTTTTCATTGCTTAT
CAATCCTCCATATTGATAATTTCACAGTTACTTAATAGTTCCATGAACTAAAAGTTAATA
AAAAAAGTTTTAAGGAAATATAAAATTTTACATATTTAGTAGACGTCTTATTTAATTTCG
ATCTAGTGAAACTACATCTGAAAATTACAAAATAGAAATAGGAAATTTCATATGTATTTT
TCATAGATCTTTCTATTTTTCCAAATTAAAATTTGTTATTTAATAAAATACTAAATCATT
TATGATTTATATTTACAATAAGATAAAAATAACTTTGGAGATTCTCTAGATAGACTTAAC
AGGTTCACTGGCTCATAAGTTACTTAGTAAACTCCATCAACAGAAATAAAGAATTAGGCT
TAGACTGATCTAGATTTATAAAATAGAGTAAATCAAATATAGAACTAATCTAAATCTAGT
GAATCAGTAATATCTGCGTTACCTACTCCAATAAATTCTGTATAACCAATATAAACAAAA
ACTACTCAAGAATAAAAGAATAGTAGCTACATACCAACATCAGATGATTTTAGAGGTAGT
TTATTGTTAAATAACTTAGAAAAATCTACTCAAAACCAAATAAGAAGCGATCTATTTAAA
AGCATTGAAGGGGTAAATTCAATAGTCTCCCCTAATTCTAAAAACCAAAATAAATCAAGC
TTTGGAGATTTTAGTAGCTAGAACTAATAGCAAAATAAGGTTTAAGGTGTAAGTGACTAC
ACATCCTACCAATACTAATCTTAAGTAAGCAGTACTCCAAGCAATCCTATTTTCCAAAAA
ATAGAACCTTCTGCTTTGACTAATAATAACAGTGCTAATAAATAGCCTTTGGAGAAAAAT
AATTAATACTAATTACCATCTAGTGTTACATTTAGTGCTCTTCCTTCTGTTACTTCTTAT
ATGCCATTAACCCAAAGTATTTAATAAAATACTGTATAGGGTGAAGGATTACTCAATCGT
TTAGATAACAAAAACGATAATAAAAAACAGAATGCAAATTCTTAATAGAATCCAGTTAGT
GAGCAAATAGTAGACAGTATTTTGAGTGAACCTTTTGCTCCTTAGCCAACTGCTAATTTT
GATACCCGCTCTTCAATCAGCTCAATCAAAAGAGAGCCTATTAGTTACCCTGGAAACACA
TATACTGCATCAGTTAGCGGAATTCCAATTTAACCCTATTCATCTTGGACTAATCCAGTA
AGCTTGAACTCGAGTGGAGGAACAGCTGCATTTTTGGGCTTACCAGTTTCATAGTAAAAC
AAAAACTCTCAGCCATAAACTAATTAAAATAGTGCCAACTAAACCTTGTTTGTTTCTTTT
GGTAATGAAAAGATTTTGGGAAGTAATCCATTAAAATCTTCAGTTCCTGGTACTAATAAG
GATTAAATTTTGTCAGGACTACCAACATACACACCATCAATATTGATGAGCACTTCTTTT
AGTAAATTACCAAACAATTCGTTCAACTAAGGAGAAAAAGATAAACAATCATCTGTAAGA
TCATCAGGAGCAGTCTCTAACGAGTATAAGTAAGCCCTCTATTAAAAACAAAATATCATT
CCAGCAAGCGATTAACTTACTGCTGGTGCCCTTAAAAGCAATCCTACTACTTATGTTTCT
AATTAAAAACCTTCAATAAATATTGGTAATATTAACCAAGGTTCTTACACTACTTCTTCT
TTAACTGGAGTCGATGCTTACATTCCACTTACTACTGGTGCTTCTGCTCTGATTTCGCCC
AGAACTCAAGAATTAAATTCCTACAAGATCACCACTTCAGCCCTAGTCCCAAGTAGCAGA
TAAGTTGTAATTGGTAATCCCAGTAGTATTGAAACTTCAGATTAGAAATATAATAAACGC
TTATCAATAACGAGTGATGTCATCGAAGAAGATCCAAAGCGCAGCAACAACTAAGATAGT
GCTTCAAAGCTCGGAAACAATACGCTAAATTCTTCTGCAGGCTTTATCGGTTACAAGAAA
AAAATAAAAATACAGCCATCTCCATAGGTGATAAAGGAAACACATCTTCCTGTAATTCGC
AGTAATTCCAATAATAATAGCAAAGATTCATCATTTTTCCTTAATAACAATTCTTTTTCA
TAAAATAATCCAAAAATACCAAACCCTACTTCTGTAGCTGCAGGTAATAATAACTATATA
TTGAATAATTCTTTCAGCAACTTAAATAACTCATTTTCTGGTGCACCTAAAGACACAATT
ACAGCTGGAACAAATTTCAATAATTTTTTGAATAGCTCATTCACTGATGAGAAATCTAAA
TAACAAAGAAATACTCTTGACAAACTTAATAAATAAGGCTAATTAAATTAGGTAAATGGT
TTAATTAAGAGTGGTGAATCATAATAATCATAATAAAAAATTTCTTAATTCAACTCTCCT
TAATCTTAAAAGATAGCTAGCCAACTTGCCTCTACTTAGAATCTGAATCGTTTTGCATCA
CCTTAATCAGATACTTCGAGAGGATCTGTTTCTTTAACAAAAAAAACTAATGTCACTGTG
GTGCATACTCCAGGAACAGAAGGTGCTATATCCTTAGTTAGAGCCATCTAAAATACTTAC
ACTTATAACGAACCTACTCATAACGATGATAGTTTCCACAATAGCAGTTTTAACAATTTG
AACAAATCACTTCTCGATTCCCAGGCCTCACAATATTTGGTATACATTTGA


>TTHERM_00703320(protein)
MKEQESGNLEKRIKLIEYRNGIYQGMIHPNEDRTNLGIYTWDSGEVYFGEWKHDMLDGEG
ILFFPFGGFIHGFFMKNKLNGAAFFKFSNGDIYEGFWRNGKLEGNCYKYFCDEERWILSD
YKNGEFKKIISKGDGQPPSYVFNYITSTSDIAVKHQDDTFQQDGLKIEAINFNDGGQYLG
LIKNSMPTSLGIFKYSDGKYDVGYYKDGSLDGLGRLNLHNGDVFDGFLQKGLFNGIGVFF
QKQSCSWIYGNFENNKCVNILKKGQGAFPIEIIEKFRSENHRKAKKYIDKITPLDVYFAP
MYNHIPIGPEKHNFYLDLSITNQANLSNNGGSQQKIPEQLPMKKVLPKDLTSSDYQSPPQ
KRSQSKGKTQQVPLKTPSVSSSLVSSANRQDNQNLKKDRQSSKSIGKSQTMQAQQQNPKI
FVSQSSQGQDLKQSQQQQQDKKSNSKKEVPKKQNLVSPPPRQGRLGAQQQQSNQSSAKKS
NLKKAKQNSSNSNKQRSRQSSVSKIQNEKQEIDQQSIHDYDNMVKLMSQHQEGQINISQS
QGQNINFDEVFNTESSPKSQQIQQREFKQQKSLAQIIGSEEIDEPKQFPYQKSKSMAVFN
SKKSSQASSVKQQNIHEIGNVSKISGIGQSDTSGVYKDNNRSGVANQGDFTGIIKPNIFG
KKSSSAPKQAKQVQNKQKDDKSGTNNEQSDSDSSFSSYSSDRVVRKQTAPPTSGRKQIAI
IKEEERMRSYSGTPANRFVESYTNRDYFGSRDDQVSSGGKSYKNEQDLRESLEEEENKQF
LEAERLSKEEVESKIERAHDKKNNDQDEEYGHIKIKDIINVDDQSNQNSHVGEQSRKGAD
STPHNQFITIQNQKNKPIQIQKNEQIISDKQGFNQIEKDNDTPISKKLEDLQHLAQNRDI
QKMYQSKKSNSILELENIRNEIANYEQIAQQDLPQRSKKSKQGKKDTSRETSHPRTPQSI
VTPKHLPSQSPNFQQSPILTSLPNPKIQYQQEEELDLEESEHVLDSIKQIKQQMIHQLNH
LENKQREVTTPAASNFKYNIAPNFNIPNDENHILKDDSLNQDISPQNPIENFESPFKKDS
LVYERENSQGRGRSTNHSRVENSRSYKYYTEEEANQIAQKIEQNLAFQGDQTNKQTKVSE
NERGENFINEESVQVGDINEEIQIDDQRAGREDRVVRSKLERDSEMHDIQEKQIQDSILQ
AEKLNQMLDGNTNQQRLNQIQSYQRQQNEQMRLSAQGQQEFLASQKIDEQNQNQKTQAAQ
INQQNQQGQSQQNIKNHSVAASPNSQSPINQIQQRSISPQSNSLNSSQITAGQVIQVVKE
ILPPTQQTTIYQKKLSDNAIQSTVVTKTIQPIVTTKIISPVRSRPSSQSNSPLTKQNQNA
LQNNSPGKFNSQIISQQLLPQQVLGQLQSIIGGGNSNQQGQQPANQNKIYSDRTQNRIVQ
AVNQQWKQKNPELFQNITPMEFYQSIVQRQNILKDLSPEQLEQLEQDIKTLKQMNVADDL
QIILEQNISNVTSPLNASNNTDIKHYTFQGDDITPSLQRRKQEEELAATAAKTALDVTAA
AEKARKEYEIQQQHLQNQLALTQNHTLLTQQQQKEIQELKKQQEEFIKQQLEIQKQQAEY
LEKLQKQQALIIQQGEEQRKRHEEEKTRQLKEIEALEKQKNQRIIEEEERLKQLRDMQEM
VRQQIEDDLQRKKLEDEEHRKRQKALFDKEQEILDRLQDEQVKLSQLQQEQARLQAQELE
NKKVRDMQLKMEEELRKKEEEKLEQLKIQSASLNEEIKNNQSRSEEERVKMHQLQLKYAE
DQRKQQEILDELNSQKLLKENSQRQQDIIQQQDILEQQKQINEQQYALQQEQLRIQRERE
ELEILQKQRNEESFINEQQRLAILQSKEQELEQQIRQQNQSFLAQQEELQRQKQQLESQK
LDLILEQDRLKKKSDLDDAKLKDVEKNLQEQLSKIENEKDQQIQRDQEIQARVRQESINA
QQEELQRQKQQIEFQKQDLIIEQERLRQKLKEEEEKRLEAERILQETILKKQLEDSATVQ
LKNQVDLEKLEQQKQIEIKLREQQEQIKREKEQLERERQQQEYEKQKQHEKEKEVIELQN
ALKQKQLFLEQQQRETQLKLEQQFKEQQEQMLREKTEIEKQKIIQEQQKQKQIELEQAAK
QQEERLKQQKLLLELEQEQKKRDAEQQLRFQQEQIQKEKEEVQKQKELLAQMEREKIAME
LARQQKEQEERRKIEEQEKRDNYFKKVDVFTKEIESRRGYISPRQSSLDIPPSTQVILNN
PSTLENKDSSNLLFKTNQSASSSPINTNRSDIETMIRESQARLKQSIAQSVQQVDKIGQI
VNPYQDISIKNSESAEAVKRSTHQPTTTQYPITNTNLQQESQPQKDILESYSQQKNIDLF
NQIDKIVRSASQSASTSPIGTNNNKNNFGDSLDRLNRFTGSQVTQQTPSTEIKNQAQTDL
DLQNRVNQIQNQSKSSESVISALPTPINSVQPIQTKTTQEQKNSSYIPTSDDFRGSLLLN
NLEKSTQNQIRSDLFKSIEGVNSIVSPNSKNQNKSSFGDFSSQNQQQNKVQGVSDYTSYQ
YQSQVSSTPSNPIFQKIEPSALTNNNSANKQPLEKNNQYQLPSSVTFSALPSVTSYMPLT
QSIQQNTVQGEGLLNRLDNKNDNKKQNANSQQNPVSEQIVDSILSEPFAPQPTANFDTRS
SISSIKREPISYPGNTYTASVSGIPIQPYSSWTNPVSLNSSGGTAAFLGLPVSQQNKNSQ
PQTNQNSANQTLFVSFGNEKILGSNPLKSSVPGTNKDQILSGLPTYTPSILMSTSFSKLP
NNSFNQGEKDKQSSVRSSGAVSNEYKQALYQKQNIIPASDQLTAGALKSNPTTYVSNQKP
SINIGNINQGSYTTSSLTGVDAYIPLTTGASALISPRTQELNSYKITTSALVPSSRQVVI
GNPSSIETSDQKYNKRLSITSDVIEEDPKRSNNQDSASKLGNNTLNSSAGFIGYKKKIKI
QPSPQVIKETHLPVIRSNSNNNSKDSSFFLNNNSFSQNNPKIPNPTSVAAGNNNYILNNS
FSNLNNSFSGAPKDTITAGTNFNNFLNSSFTDEKSKQQRNTLDKLNKQGQLNQVNGLIKS
GESQQSQQKISQFNSPQSQKIASQLASTQNLNRFASPQSDTSRGSVSLTKKTNVTVVHTP
GTEGAISLVRAIQNTYTYNEPTHNDDSFHNSSFNNLNKSLLDSQASQYLVYI