Identifiers and Description

Gene Model Identifier

TTHERM_00705040

Standard Name

PELO1 (PELOta 1)

Aliases

PreTt26859 | 111.m00080 | 3744.m00001

Description

mRNA surveillance protein pelota protein; eRF1 domain 3 family protein; homolog of protein pelota; functions in mRNA surveillance pathways of non-stop and no-go decay

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17708.1 9.997093137033517e-262
Description: eRF1 domain 3 family protein (447 aa)
DictyBase DDB_G0280447 5.000356947592888e-100
Description: pelo on chromosome: 3 position 3368362 to 3369914
WormBase WBGene00011280 9.999030951775615e-88
Description: Uncharacterized protein R74.6 status:Confirmed UniProt:P50444 protein_id:CAA85277.1
Oxytricha Contig17990.0.g10 1.999469658314961e-75
Description: eRF1 domain 2
SGD YNL001W 3.000235161122315e-61
Description: DOM34 Protein that, with binding partner Hbs1p, facilitates ribosomal subunit dissociation when translation is stalled; required for RNA cleavage in no-go decay, but reports conflict on endonuclease activity; Pelota ortholog
Stentor Coeruleus SteCoe_37274 2.2273635617957438e-39
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00705040(coding)
ATGAGAATTATAAAAAGATATATTAGCAAGGGCGAAGGCTATTTAACTTTAGTTCCTACT
GAGGAAGAAGATTACTGGCACATTTATAACTTAGTTTCTAACGGTGATATTGTCCGTTCT
GCAACTTTCAGAAAGATAACCAAGGAGTCAAAGACAGGAGTTAAAGATGTCATTAAAAAG
AAAATTACTCTCACTTTGAAGATCGTTGCTATTAATTACTATGCAGGCGAGTTCCTGCAA
CTTTCTTTGAAGGGAAGAAACATAAAAGAAAATGATTACCTAAAGATGGGTTAATTCCAT
ACTTTTAATTTAGAATTAGACTAGCAGATTACTATCATTAAATAAAATTGGGATTCTTTC
CATTTTAAGATTATTAAGGATATTTCTGACCCTACTCATGATTCAGAACTAGCTGCATTT
GTTATGGATGAAGGAATAGCACATTTGTGTTTCATAAAATCTTCAATTACAATAATGAAG
CATAAAATAGAAAAGCACATACCTAAGAAGAAGAGTGGAGCCGAGCAACATGACAAGGCA
ATGGAAAAGTTCTTCGAAACCTGCTTTGAGTATTTGGTAACTGTTAATTATGATTAAATA
AAGTGCCTTGTTATTGCTTCTCCTGGTTATGTGAAAGATGATTTCTACAAATATATATAA
GATTAGTTGCAGAGAGCGGATCTAGCTGCATTCAACAAGAGGTCAAACTTCCTTTAAAAG
ATAGTCAGAGCTAAGTCATCAACAGGATATTTGAATAGTTTAAGTGAAGTATTGAGTGAC
CCCACTATCTAAGAGTAGTTAAAAGATACAAAGGCTATCAAAGAAGTGAGAGCTCTAGAT
GATTTTTACAAGGTTATGAGTAAAGATCCTGATATGGTTTGCTATGGATAAAAGCATGTA
TTTAAAGCATACGAAGATAATGCTATTTAAACCTTACTTTTGAGTGACAGTCTTTTTAGA
ATTAAAGATTTGAGTTAACGTAAAAAATTCAATAATTTGATCGATGACACTAAGAAGAAG
GGAATTGACTCTTTGATTTTCTCTAGTTTGCACAGTAGTGGAGAAAAATTAAATAATTTA
ACAGGTATAGCAGCTATCCTTAGATATCCTATCCCTTATGAAGACGAAGAGATGGAGTAA
TCTGAAGAAATAGTTGAAAATTTTAGAGTAAAGATAGAAGAAAGAGAAGAAGTCGAAGAC
GAAAAATCCATTATGGGAGATGATGAAAAATTAGAAGCTGAAAGAATAGCAAAAGAGTTA
GAAGCATTTTCTTTAGATAATTTAGACGAAGAACAAAAGCAAGATGAAGACGAAAATCTT
TGA


>TTHERM_00705040(gene)
ATGAGAATTATAAAAAGATATATTAGCAAGGGCGAAGGCTATTTAACTTTAGTTCCTACT
GAGGAAGAAGATTACTGGCACATTTATAACTTAGTTTCTAACGGTGATATTGTCCGTTCT
GCAACTTTCAGAAAGATAACCAAGGAGTCAAAGACAGGAGTTAAAGATGTCATTAAAAAG
AAAATTACTCTCACTTTGAAGATCGTTGCTATTAATTACTATGCAGGCGAGTTCCTGCAA
CTTTCTTTGAAGGGAAGAAACATAAAAGAAAATGATTACCTAAAGATGGGTTAATTCCAT
ACTTTTAATTTAGAATTAGACTAGCAGATTACTATCATTAAATAAAATTGGGATTCTTTC
CATTTTAAGATTATTAAGGATATTTCTGACCCTACTCATGATTCAGAACTAGCTGCATTT
GTTATGGATGAAGTAATCAAAATTTTTTATTAAATTTAAAGTTTGTTTGAATTTCAACAA
CTAAGAAAAGAAATGTTAAATGCTTTTTGAAATATAGAAAAAAATTAATTAGTTTGTTTT
TGTAATGATGAATTATTTAATAAATGATAGGGAATAGCACATTTGTGTTTCATAAAATCT
TCAATTACAATAATGAAGCATAAAATAGAAAAGCACATACCTAAGAAGAAGAGTGGAGCC
GAGCAACATGACAAGGCAATGGAAAAGTTCTTCGAAACCTGCTTTGAGTATTTGGTAACT
GTTAATTATGATTAAATAAAGTGCCTTGTTATTGCTTCTCCTGGTTATGTGAAAGATGAT
TTCTACAAATATATATAAGATTAGTTGCAGAGAGCGGATCTAGCTGCATTCAACAAGAGG
TCAAACTTCCTTTAAAAGATAGTCAGAGCTAAGTCATCAACAGGATATTTGAATAGTTTA
AGTGAAGTATTGAGTGACCCCACTATCTAAGAGTAGTTAAAAGATACAAAGGCTATCAAA
GAAGTGAGAGCTCTAGATGATTTTTACAAGGTATCAAAGATATGAATTATTTTATTAAAT
AGAATGAAAGTGTTTTTATTTATTGCTTTAAATAATTTTATTAATTACAAAATAGGTTAT
GAGTAAAGATCCTGATATGGTTTGCTATGGATAAAAGCATGTATTTAAAGCATACGAAGA
TAATGCTATTTAAACCTTACTTTTGAGTGACAGTCTTTTTAGAATTAAAGATTTGAGTTA
ACGTAAAAAATTCAATAATTTGATCGATGACACTAAGAAGAAGGGAATTGACTCTTTGAT
TTTCTCTAGTTTGCACAGTAGTGGAGAAAAATTAAATAATTTAACAGGTATAGCAGCTAT
CCTTAGATATCCTATCCCTTATGAAGACGAAGAGATGGAGTAATCTGAAGAAATAGTTGA
AAATTTTAGAGTAAAGATAGAAGAAAGAGAAGAAGTCGAAGACGAAAAATCCATTATGGG
AGATGATGAAAAATTAGAAGCTGAAAGAATAGCAAAAGAGTTAGAAGCATTTTCTTTAGA
TAATTTAGACGAAGAACAAAAGCAAGATGAAGACGAAAATCTTTGA


>TTHERM_00705040(protein)
MRIIKRYISKGEGYLTLVPTEEEDYWHIYNLVSNGDIVRSATFRKITKESKTGVKDVIKK
KITLTLKIVAINYYAGEFLQLSLKGRNIKENDYLKMGQFHTFNLELDQQITIIKQNWDSF
HFKIIKDISDPTHDSELAAFVMDEGIAHLCFIKSSITIMKHKIEKHIPKKKSGAEQHDKA
MEKFFETCFEYLVTVNYDQIKCLVIASPGYVKDDFYKYIQDQLQRADLAAFNKRSNFLQK
IVRAKSSTGYLNSLSEVLSDPTIQEQLKDTKAIKEVRALDDFYKVMSKDPDMVCYGQKHV
FKAYEDNAIQTLLLSDSLFRIKDLSQRKKFNNLIDDTKKKGIDSLIFSSLHSSGEKLNNL
TGIAAILRYPIPYEDEEMEQSEEIVENFRVKIEEREEVEDEKSIMGDDEKLEAERIAKEL
EAFSLDNLDEEQKQDEDENL