Identifiers and Description

Gene Model Identifier

TTHERM_00705190

Standard Name

TRM112 (TRNA Methyltransferase 112)

Aliases

PreTt26874 | 111.m00095 | 3744.m00016

Description

TRM112 tRNA methyltransferase-like protein; tRNA methyltransferase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17719.1 9.003714852256964e-78
Description: hypothetical protein (125 aa)
Oxytricha Contig18162.0.g15 1.999981404597394e-31
Description: Trm112p-like protein
DictyBase DDB_G0285489 9.998720540547892e-23
Description: DDB_G0285489 on chromosome: 4 position 3308405 to 3308952
SGD YNR046W 9.997019043202629e-21
Description: TRM112 Subunit of tRNA methyltransferase (MTase) complexes in combination with Trm9p and Trm11p; subunit of complex with Mtq2p that methylates Sup45p (eRF1) in the ternary complex eRF1-eRF3-GTP; deletion confers resistance to zymocin
Stentor Coeruleus SteCoe_30780 0.00000000000009357622968840175
Description: None
WormBase WBGene00007312 0.000000000007996637300921877
Description: TRM112-like protein status:Confirmed UniProt:O45241 protein_id:CAB03840.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00705190(coding)
ATGAGATTGCTTTCCCACAATTTACTCTAGTGCAACGTTAAAAATTGCAAATCAAATAAT
TTCCCCTTGAAGATTTAGGTCGATAAATCCAACATTATAAATTGCGAATTCCGTAAGGAA
CCTCTTGTTAAGCTCATTCCTAAATTAGATTGGAATGCCTTAGCTATTACTGTCCATAAT
CTTGCTAAGAATAAAGAATTCCCTGAAAAATTTAGCCCTGCTCTCTTAGATGATTAAAAG
TTTATGCAAGAATTACACAGAATTTTGATGGAAACTCATATTATTGAAGGTGCTTTAATC
TGTGAAGGTTGCAATAAGAGATATCCCATTAAAAATGGTATCCCCAACATGATTTTAAAT
GATGAAGAAGTTTGA


>TTHERM_00705190(gene)
ATGAGATTGCTTTCCCACAATTTACTCTAGTGCAACGTTAAAAATTGCAAATCAAATAAT
TTCCCCTTGAAGATTTAGGTCGATAAATCCAACATTATAAATTGCGAATTCCGTAAGGAA
CCTCTTGTTAAGCTCATTCCTAAATTAGATTGGAATGCCTTAGCTATTACTGTCCATAAT
GTAATAAATCTCATTTGAATCTAACAATAAAAGCACTTCATTGAAACAAGCTTTCACATT
TTTAGATTTAGCCGAATTCATTAAAATATAATTATTATTTATTTAAAACTAGCTTGCTAA
GAATAAAGAATTCCCTGAAAAATTTAGCCCTGCTCTCTTAGATGATTAAAAGTTTATGCA
AGAATTACACAGAATTTTGATGGAAGTAAAAAATAAATTTTGGTTTTCGTTTTAAAATAA
ACAATAATTAAGGTTTCTAAAGTCAAACTAACATTTTTTTTGCTGTAAAATAGACTCATA
TTATTGAAGGTGCTTTAATCTGTGAAGGTTGCAATAAGAGATATCCCATTAAAAATGGTA
TCCCCAACATGATTTTAAATGATGAAGAAGTTTGA


>TTHERM_00705190(protein)
MRLLSHNLLQCNVKNCKSNNFPLKIQVDKSNIINCEFRKEPLVKLIPKLDWNALAITVHN
LAKNKEFPEKFSPALLDDQKFMQELHRILMETHIIEGALICEGCNKRYPIKNGIPNMILN
DEEV