Identifiers and Description

Gene Model Identifier

TTHERM_00706330

Standard Name

RRM45 (RNA recognition motif-containing protein 45)

Aliases

PreTt26889 | 111.m00110 | 3744.m00030

Description

RRM45 RNA recognition motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17731.1 5.999393432078778e-90
Description: hypothetical protein (227 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00706330(coding)
ATGAGTGAAGAAGTAGCTTTAGACGAATTTATTGAAGAAGACAAGAAAAACTAAAAAAAG
AGCGATAAAAATAATAATAACAAGGGCTTTAAGAGAAACTATAACAATAATAACAACAAT
AACAACAATAACAACAACAATAATGGCAATAAATTCATTAAAAGAACAAACAATAAGCCC
AATATTCATAATAATAATAACAACAACAATAATAGAAATAATAACTACCGCAACAATAAG
GAAGACAGATATGAAAAAAACGACAATAAAGATAGATATCATTAAGTTAAGAAGATTTCA
AAGCCTATATCAAAGGGAAGAAAAGATGACAATCATAATGATTCTCATTTCGGCCAAGGT
TCTAATTCACAAAATCCTCCAAGACAGTTAACAATAAATGCCGGTAAGAAAGTGACCATT
CCTAAGAAACTCTACACAGTAAAGGTTAAGAATCTTCCTTCTAGCATTAATTCTCATGAA
ATATATGAACTTGCCTCTGATAAAGAATAAGTTAAAGTTGACTCAATTACTACCACATTT
AATTGCAACTCTGACTCTAAATTAATAGAAGCTGAAATATCATATTACTAGCTTAGTGAT
GCACAAACCTTTGTTCAAAATTATAATGAAGCCACATTAGAAAATTAAGAATTGGAGGTT
TTATTAATTAACTGA


>TTHERM_00706330(gene)
ATGAGTGAAGAAGTAGCTTTAGACGAATTTATTGAAGAAGACAAGAAAAACTAAAAAAAG
AGCGATAAAAATAATAATAACAAGGGCTTTAAGAGAAACTATAACAATAATAACAACAAT
AACAACAATAACAACAACAATAATGGCAATAAATTCATTAAAAGAACAAACAATAAGCCC
AATATTCATAATAATAATAACAACAACAATAATAGAAATAATAACTACCGCAACAATAAG
GAAGACAGATATGAAAAAAACGACAATAAAGATAGATATCATTAAGTTAAGAAGATTTCA
AAGCCTATATCAAAGGGAGTAATAGAATTAGAAAATTTCTCATATAAATCATTTCTTAAT
TCCAAAATTTGTTTCTGATATCATTTTATCTTTTGCATTAAACTTAAACTCAATTGTGTC
TAATCAATTTAATTTTTTTCTAATCAATATTAAAGAGAAAAGATGACAATCATAATGATT
CTCATTTCGGCCAAGGTTCTAATTCACAAAATCCTCCAAGACAGTTAACAATAAATGCCG
TAAAATATACTGATTTATATCTAATTTTACATTTTTGTCTAAAACATATTATTTACTGTA
TATTTTCTTATAATAAAAGGGTAAGAAAGTGACCATTCCTAAGAAACTCTACACAGTAAA
GGTTAAGAATCTTCCTTCTAGCATTAATTCTCATGAAATATATGTAACTAACCATTTAAT
TTATCAATAAAATTATAAAACAATAATTTTTATCCCAATAGGAACTTGCCTCTGATAAAG
AATAAGTTAAAGTTGACTCAATTACTACCACATTTAATTGCAACTCTGACTCTGTATTTA
TTTACTTATTATATTTATTGCCTACTAATAATTGGCCTCTTATTAATATTTTAGATTTTG
AAATTAAATTAATTACTTAAATGTTTTTTTTGTAATAGAAATTAATAGAAGCTGAAATAT
CATATTACTAGCTTAGTGATGCACAAACCTTTGTTCAAAATTATAATGAAGCCACATTAG
AAAATTAAGAATTGGAGGTTTTATTAATTAACTGA


>TTHERM_00706330(protein)
MSEEVALDEFIEEDKKNQKKSDKNNNNKGFKRNYNNNNNNNNNNNNNNGNKFIKRTNNKP
NIHNNNNNNNNRNNNYRNNKEDRYEKNDNKDRYHQVKKISKPISKGRKDDNHNDSHFGQG
SNSQNPPRQLTINAGKKVTIPKKLYTVKVKNLPSSINSHEIYELASDKEQVKVDSITTTF
NCNSDSKLIEAEISYYQLSDAQTFVQNYNEATLENQELEVLLIN