Identifiers and Description

Gene Model Identifier

TTHERM_00715720

Standard Name

AAG1 (homolog of AlkylAdenine DNA Glycosylase 1)

Aliases

PreTt19046 | 113.m00085 | 3673.m00009

Description

3-methyladenine DNA glycosylase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF02245 ) Methylpurine-DNA glycosylase (MPG)
  • ( TIGR00567 ) DNA-3-methyladenine glycosylase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16844.1 1.9996161777617176e-164
Description: DNA-3-methyladenine glycosylase (241 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_00715720(coding)
ATGTAAAAACAAAAAAGGCCACAAGAAGATATTGAACAGCCAAAGCAAAAATCTATATCA
GATTTTTTTGGAAAAAAGGCTAGCGCAAAGAAGGCTGATGATGATTAACTAAAATAAGTA
CCAGATAGCTTTTATGAAAAAGATGTTGTGACATTAGCATAAGATTTACTAGGAAAGCTG
ATTGTTCATAAAACAAAAGATGGGATAATTGCATGCAGGATAGTAGAAACTGAGGCTTAT
AAGGCTCCAGAAGATAAGGCGTGTCATGCGTATAAAAATAAAAAAACTGAAAAGACAAGC
TCATTTTGGCTTCCAGGAGGTCATGTATATATGTTTACAATTTATAATAATACTTGGTGC
TTTAATGTTGTTGCAGCCACAGCTGAAGAACCAGAAGCTGTTCTTGTTAGAGCTGTAGAG
CCAATTAAAGGACTCCATTTAATTCATAGAAATAGATCCTCACTGAAATCAAATAAAACC
GAAGATTTAGTTAATGGACCTGGAAAACTTACATTGGCTATGGGCATCACCAAAGAAAGA
AATGGATTTGATATGAGAGGAGAAGGAAAAGATTTATTTATAGCAGAATCACCTGAAAAT
TTAAAAAAGTTTGAAATAATTGCAAGCAAAAGAATAAATATAGATTATGCAGAAGAGTGG
ATAGATAAATATTGGAGGTTTACAATCAAAGATAATAAATTTGTTAGTGTTCCCTTGTAA
TTTTGA


>TTHERM_00715720(gene)
ATGTAAAAACAAAAAAGGCCACAAGAAGATATTGAACAGCCAAAGCAAAAATCTATATCA
GATTTTTTTGGAAAAAAGGCTAGCGCAAAGAAGGCTGATGATGATTAACTAAAATAAGTA
CCAGATAGCTTTTATGAAAAAGATGTTGTGACATTAGCATAAGATTTACTAGGAAAGCTG
ATTGTTCATAAAACAAAAGATGGGATAATTGCATGCAGGATAGTAGAAACTGAGGCTTAT
AAGGCTCCAGAAGATAAGGCGTGTCATGCGTATAAAAATAAAAAAACTGAAAAGACAAGC
TCATTTTGGCTTCCAGGAGGTCATGTATATATGTTTACAATTTATAATAATACTTGGTGC
TTTAATGTTGTTGCAGCCACAGCTGAAGAACCAGAAGCTGTTCTTGTTAGGTATTTATTT
AAAATTCTTTTAAAATTTATTATTAACTTATTTATTTTTTATGTAGAGCTGTAGAGCCAA
TTAAAGGACTCCATTTAATTCATAGAAATAGATCCTCACTGAAATCAAATAAAACCGAAG
ATTTAGTTAATGGACCTGGAAAACTTACATTGGCTATGGGCATCACCAAAGAAAGAAATG
GATTTGATATGAGAGGAGAAGGAAAAGATTTATTTATAGCAGAATCACCTGAAAATTTAA
AAAAGTTTGAAATAATTGCAAGCAAAAGAATAAATATAGATTATGCAGAAGAGTGGATAG
ATAAATATTGGAGGTTTACAATCAAAGATAATAAATTTGTTAGTGTTCCCTTGTAATTTT
GA


>TTHERM_00715720(protein)
MQKQKRPQEDIEQPKQKSISDFFGKKASAKKADDDQLKQVPDSFYEKDVVTLAQDLLGKL
IVHKTKDGIIACRIVETEAYKAPEDKACHAYKNKKTEKTSSFWLPGGHVYMFTIYNNTWC
FNVVAATAEEPEAVLVRAVEPIKGLHLIHRNRSSLKSNKTEDLVNGPGKLTLAMGITKER
NGFDMRGEGKDLFIAESPENLKKFEIIASKRINIDYAEEWIDKYWRFTIKDNKFVSVPLQ
F