Identifiers and Description

Gene Model Identifier

TTHERM_00716240

Standard Name

RPL2 (Ribosomal Protein of the Large subunit 2)

Aliases

PreTt19096 | 113.m00135 | 3673.m00059 | RPL8

Description

RPL2 60S ribosomal protein L2/L8; Homolog of yeast RPL2- human RPL2; C-terminal domain containing protein- Named RPL8 in Klinge et al. Science 2011

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00181 ) Ribosomal Proteins L2, RNA binding
  • ( PF03947 ) Ribosomal Proteins L2, C-terminal domain
  • ( TIGR01171 ) ribosomal protein L2

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16896.1 9.997093137033517e-262
Description: ribosomal Proteins L2 domain-containing protein (264 aa)
WormBase WBGene00004413 6.998011703086592e-119
Description: locus:rpl-2 60S ribosomal protein L8 status:Confirmed UniProt:Q9XVF7 protein_id:CAB03792.1
Oxytricha Contig22518.0.g91 8.997487055918214e-111
Description: Ribosomal Proteins L2, C-terminal domain
SGD YIL018W 6.0025840010353464e-108
Description: RPL2B Protein component of the large (60S) ribosomal subunit, identical to Rpl2Ap and has similarity to E. coli L2 and rat L8 ribosomal proteins; expression is upregulated at low temperatures
DictyBase DDB_G0274113 1.0000198575659891e-106
Description: rpl8 on chromosome: 2 position 4593609 to 4595098
Stentor Coeruleus SteCoe_35015 2.820770088460135e-53
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00716240(coding)
ATGGGTAGAGTTATCAGAGCTCAAAGAAAGGGTCGTGCTAATGGTGTCTACAAATCTCAC
AAGAGTGGTAGAATCGCCCCCGCTCAATACAGAGTTTACGACTTCGCTGAAAGATAAGGT
TACATCAGAGGTTGCATCAGAGACATCGTCCACGAACCTGGTAGAGGTGCTCCCTTAGCT
GAAGTTGCTTTCAGAGATCCCTACAGATACAAGACTAACAAAGAACACTTCATCGCCGCT
GAAGGTTAATATTCCGGTTAATACGTTTACTGCGGTTTGAAGGCTCAAATCGCCGTCGGT
AACGTTCTTCCCATCAACAGAATCCCCGAAGGTACTGTTGTTTGCAACGTCGAAGAAAAG
GTTGGTGACAGAGGTACTTTCTCTAGAGCCTCCGGTTGTTATGCCACCATTATTGGTCAC
TCCGAAGATGGTGACAAGACCAGAATCAGATTACCCTCTGGTGCCAGAAAGACCATTCCT
GGTTCTTGCAGAGCTACTGTTGGTATCGTCGCTGGTGGTGGTAGAACTGATAAGCCCATC
CTCAAGGCCGGTAACCAATTCCACAAATACGCTAGAAAGAGAAAGTCATGGCCCAGAGTT
AGAGGTGTTGCTATGAACCCCGTCGACCATCCTCACGGTGGTGGTAACCATTAACACATC
GGTCACCCCGCTACTGTTTCCAAGTGGGCTTCTGCTGGTCAAAAGGTCGGTCTCAGAGCT
GCCAGAAGAACTGGTCTCGTTAGAGGTGGTCAAAAGGAAAAGATGGCTATGAAGGCTGCT
GCTGCTGGTGTTTGA


>TTHERM_00716240(gene)
ATGGGTAGAGTTATCAGAGGTACTATAAACTTAAAGACAACGATTGTCAATTTTAATGAG
GGAGCAAGAAGGATAGCAAGCTGAAAGCAAATGACTAATGATTTGGCTAATTCAATTTAA
TTTAATTGGTTTAAATGCAAAAAAATGCCATCCATCAATCACTAAAATCATTAGAAATAA
ATAATACTTTTCTTTTGTTAATTATCAATCAGTCAAACATCTTTCTCTTCAAACTTCTTG
CTCTCTCATTTCTCATATTTATAATCATTCCTATCTAAACAATTCTCTTATTTAAAATAA
TATAGCTCAAAGAAAGGGTCGTGCTAATGGTGTCTACAAATCTCACAAGAGTGGTAGAAT
CGCCCCCGCTCAATACAGAGTTTACGACTTCGCTGAAAGATAAGGGTAATTAACATAACT
TTGATAATGTACAAACAAATAATATATTTTCTCACTCTCATAATACAAACAATCCTTTGT
CAAAAACCTAATCTAACATATTTTCTTCTCAATACTCCCATTCGATTAACAAACAACTGC
AATAGGAATTCTTGCAAGTTTGTCTTCACAAGCAAGGAGTAATAAAAAGGAAATTAGAAA
TGTTTATTAGCAATTCATTAAAAATAGCTAAACTCTCTCTTCTACACAAAGTGAAAGTAG
AAAATAAATCCCACAATAAATCAATCAACAATTAAATTTAGAAAAGATAGCCTTTAAATT
ATTTCTAAACCCCGTTTAAGTAAGATGTAATAAGATAAAAGAGGTTTAAGGTTTCAAAAG
AAAAGTTATAATGCATTTAATGAATGAATAAATGAAGTTAGGTTTTATTTGAAGTCAAAA
TCACAAATATGGTACAAGAATAATTTTATTTAGCTTTTAGGTTCTGTCTGATAAAAAAGG
AAATAAAGAGATAAAACATTTAAATTATTTCGTCATTGTTCATTTAGTGGGATTTGCGTA
CCATAACATATATAAATGTATTGTACAAGTAAATATATGAGCTATTTTCACACTGAAAGA
TATAAAAGCCTTTCGCTAAGAAATCAACTAAGTTAGAAAGAAAGAATGATAGAAAGAGAG
AGAGAGTTAAAGAATTATATTTAGAATTAATCAGTAGAAGAATTTTTTTTTATTAATCAT
CTCAAGAAAAAATTTAGAAAACAACAGAATGAGCAAAAAAAGTATATTTAGCAGCAAAGA
TAAACTAATAAGTCAATAAGGGAATAAGCTCCTCAATTGAACAAACAAACAAATTCATTA
AGCAAATAAGTTTTTATTTAGATAAATATTTTGAGGCTTATTTCTTTCTTACAAGAGATT
ATGAGCAAGCTTAAATTTATTTAGATATAATGAAAAAATGAATTTAAAGTAAAATCAACA
AGTAGAATTTATCAAACAATTATTATGAATAATAAATAATCAATGAAGGTGGTTAAGAGT
GTTTGTATAGAAAATTTTGCAAATAAATAAATAAATAAAGAAATTAATTTTAGAGAGGAA
TGATGAGAAATTTGTTATCTGTTTACATACATACTTTGATATAAAAACTCATTATTTATT
TATTAAATATTTTTAACCTTTTGTTGAATTTATAAAAAATAGTTACATCAGAGGTTGCAT
CAGAGACATCGTCCACGAACCTGGTAGAGGTGCTCCCTTAGCTGAAGTTGCTTTCAGAGA
TCCCTACAGATACAAGACTAACAAAGAACACTTCATCGCCGCTGAAGGTTAATATTCCGG
TTAATACGTTTACTGCGGTTTGAAGGCTCAAATCGCCGTCGGTAACGTTCTTCCCATCAA
CAGAATCCCCGAAGGTACTGTTGTTTGCAACGTCGAAGAAAAGGTTGGTGACAGAGGTAC
TTTCTCTAGAGCCTCCGGTTGTTATGCCACCATTATTGGTCACTCCGAAGATGGTGACAA
GACCAGAATCAGATTACCCTCTGGTGCCAGAAAGACCATTCCTGGTTCTTGCAGAGCTAC
TGTTGGTATCGTCGCTGGTGGTGGTAGAACTGATAAGCCCATCCTCAAGGCCGGTAACCA
ATTCCACAAATACGCTAGAAAGAGAAAGTCATGGCCCAGAGTTAGAGGTGTTGCTATGAA
CCCCGTCGACCATCCTCACGGTGGTGGTAACCATTAACACATCGGTCACCCCGCTACTGT
TTCCAAGTGGGCTTCTGCTGGTCAAAAGGTAATTTGCTTATTCTCTATAATTAATTCAAT
TTTAGTATTTTTTCTAATTAACATTTCCTAATCTTTTTTTAATAATTCAGGTCGGTCTCA
GAGCTGCCAGAAGAACTGGTCTCGTTAGAGGTGGTCAAAAGGAAAAGATGGCTATGAAGG
CTGCTGCTGCTGGTGTTTGA


>TTHERM_00716240(protein)
MGRVIRAQRKGRANGVYKSHKSGRIAPAQYRVYDFAERQGYIRGCIRDIVHEPGRGAPLA
EVAFRDPYRYKTNKEHFIAAEGQYSGQYVYCGLKAQIAVGNVLPINRIPEGTVVCNVEEK
VGDRGTFSRASGCYATIIGHSEDGDKTRIRLPSGARKTIPGSCRATVGIVAGGGRTDKPI
LKAGNQFHKYARKRKSWPRVRGVAMNPVDHPHGGGNHQHIGHPATVSKWASAGQKVGLRA
ARRTGLVRGGQKEKMAMKAAAAGV