Identifiers and Description

Gene Model Identifier

TTHERM_00716250

Standard Name

LC10

Aliases

PreTt19097 | 113.m00136 | 3673.m00060

Description

LC10 dynein light chain 4 axonemal protein; Light chain subunit of ciliary three-headed outer arm dynein (OAD)

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01221 ) Dynein light chain type 1
  • ( PF07554 ) Uncharacterised Sugar-binding Domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16897.1 9.000650761534676e-74
Description: hypothetical protein (111 aa)
Oxytricha Contig13499.0.g54 4.999723464643358e-28
Description: Dynein light chain type 1
WormBase WBGene00001005 0.000000000000006000101554955223
Description: locus:dlc-1 Dynein light chain 1, cytoplasmic status:Confirmed UniProt:Q22799 protein_id:CCD63216.1
DictyBase DDB_G0274815 0.00000019998969434520019
Description: dlcB on chromosome: 2 position 3974977 to 3975525
SGD YDR424C 0.000000600201742947405
Description: DYN2 Cytoplasmic light chain dynein, microtubule motor protein; proposed to be involved in the assembly of the nuclear pore complex

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00716250(coding)
ATGGAATAAGAAAAAGCAGTAACTGATATGGACATCAACGAGCTTCGTAAGCTCATGATT
GGTAAAGCTATCATAAATAGTTCTGATATGTAAGGAGATCTTTTACAAGAAGCATAAGAT
GTTATATAATCTGGTATTGAAAATAACTCTGCACCCGTTTTAAATATTGAGGCTGCATGC
AAATATATTAAAGAAAATCTTGATAAAAAATTTGGTCCAACTTGGTAATGCATTATTGGA
GAAGGATATGCTTATGATGTTACAGTGTAAAATAATACTTTACTATTTATGTTTTACAAC
GGAAATTTGGCTGTTTTGATTTTTAAGAGTTGA


>TTHERM_00716250(gene)
ATGGAATAAGAAAAAGCAGTAACTGATATGGACATCAACGAGCTTCGTAAGCTCATGATT
GGTAAAGCTATCATAAATGTAAAAATATTTATTTTTTACAAGGAAAGAAAGTGATAGATT
AAAAGAAGAAACTTTCAGATTGTTTATTTACATGATTGTCATATGTACTTTTATATTTAA
AAAGAGTTCTGATATGTAAGGAGATCTTTTACAAGAAGCATAAGATGTTATATAATCTGG
TATTGAAAATAACTCTGCACCCGTTTTAAATATTGAGGTAGATTTTTACTTTAGCTTTAA
ACCAACTATTTAACAATTTTGAATAATCTCTAATATATTATTTAAAATACATAAAGGCTG
CATGCAAATATATTAAAGAAAATCTTGATAAAAAATTTGGTCCAACTTGGTAATGCATTA
TTGGTAAATTATTATTCTTAAATTTTATCATATTTTTTGTATAATATTTACATATTACAA
AGCTTATTAAGTTATTTATTTATTTGCTCATTTCTTAGAAAGGAAAACATAAATATTTAT
TTATTTACTTATAAAAATAGGAGAAGGATATGCTTATGATGTTACAGTGTAAAATAATAC
TTTACTATTTATGTTTTACAACGGAAATTTGGCTGTTTTGATTTTTAAGAGTTGA


>TTHERM_00716250(protein)
MEQEKAVTDMDINELRKLMIGKAIINSSDMQGDLLQEAQDVIQSGIENNSAPVLNIEAAC
KYIKENLDKKFGPTWQCIIGEGYAYDVTVQNNTLLFMFYNGNLAVLIFKS