Identifiers and Description

Gene Model Identifier

TTHERM_00717780

Standard Name

CDK8 (Cyclin-Dependent Kinase 8)

Aliases

PreTt10873 | 114.m00108 | 3827.m00951

Description

cyclin-dependent kinase-like Serine/Threonine kinase family protein; Protein kinase domain containing protein; sequence similarity to the CDKL protein kinase family; involved in exconjugation

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07459.2 9.997093137033517e-262
Description: protein kinase domain-containing protein (597 aa)
Oxytricha Contig9279.0.0.g16 3.999155465305724e-142
Description: Protein kinase domain
WormBase WBGene00012779 9.999030951775615e-88
Description: status:Partially_confirmed UniProt:Q9U2H1 protein_id:CAB63367.1
DictyBase DDB_G0288677 1.99927841627239e-68
Description: cdk5 on chromosome: 5 position 1885785 to 1886770
Stentor Coeruleus SteCoe_6331 1.580420060273613e-61
Description: None
SGD YBL016W 1.999576471039937e-58
Description: FUS3 Mitogen-activated serine/threonine protein kinase involved in mating; phosphoactivated by Ste7p; substrates include Ste12p, Far1p, Bni1p, Sst2p; inhibits invasive growth during mating by phosphorylating Tec1p, promoting its degradation

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00717780(coding)
ATGAATAAATATGAAATTTTAGGTGTAAATGGCGAGGGAGCTTATGGAGTTGTTTTGAAA
TGCAGAAATAAAGAAACCTAAGAAATAGTTGCCATCAAAAAATTCAAAGAGACTGAAGAT
GATGAAATAGCTAAAAAAAATATATAAAGAGAAGTTAAAATGCTTAGATAGCTACGCCAT
AAAAATATTGTAGACTTGATAGAAGCTTTTAAAAGAAAAGGGAGAATTTATTTAGTATTT
GAATATGTAGAAAAAAATCTCTTAGAAGTTTTAGAAGAAAAACCAACTGGCTTAGATCAT
GAAGTTATTAGAATTATCATGTATTAACTGCTTAAGGCTCTTCATTAATGTCATAAATAA
GATGTGATACATAGAGATGTAAAGCCAGAGAACTTATTGGTTAATCCTTATAATTATGAG
TTAAAATTATGTGATTTCGGTTTTGCTAGAACTTTGCCTTCTAAGTAAGGAGAAATTATA
ACTGACTATGTGGCTACAAGATGGTATAGAGCCCCAGAATTACTTTTAAAATATCCTAAA
TATAGTAAACCTGTTGATATTTGGGCAGTAGCCTGCATTATGGGTGAATTAATTGATGGA
TAACCCCTTTTTCCAGGATAGAATGAAATAGATCAACTCTATTTGATATAGAAAACTCTT
GGCCCGCTCACTCCTGAATAAAAAGAATTATTTATTAAAAACCCTCGTTTCATTGGAACA
AAGTTTCCTGAAATAAATAAACCAGAAACTATTGAAAGAAGATATCTAGGGAAGTTAAGT
AAAAAAGCATTAAATATCATGAAGTTAATGCTAAAAATGGACCCTGATGAGAGAATAACT
GCTGAGGAAGCGATGAAACATCCTTATTTTGATGGAGTCAGAGAGTAATTTGATAAAGAC
GATAATGTTACTAAACCAGTAAGTGCAGTTACAATAGATTTAAAGAGAGAAAATTCTCAT
CTAAAGAAAATGCCTTAAACTGATAAGTAAATAAATCTTTCTAGAAAAGTTGATATTATT
GGAAAAACTGAATCGAATGATATTGATGAAAAAAACAATGGTATGGTTTAAAATAACGAA
GATCACAACGAGTATGGAGAATCTTATGGAAAACAATCAATGAAGCTTGAAAAATCAACT
AAACTATTTGGGCAAAAATCAATTCCTACATATTTATAAGGGTAGTAATTTATGTAAAGT
TCAGTTTATAATTACAAAGTATCAGATAAAAATCTTGAGGAAGGATCCTTTATAGACCAA
GATAAAAATTTGAAAAAGAATAATTAAGATAAAAGCTTGGAAAAGAAGACAGCAGCAGTA
ATACCTGCTCAAGTTGGAGACCAAATTAAAAAAATTCCTTTGAAAAAAAATTTAAGCTTA
AACAAAATACATAAGACATTTTACTAATCAGTAGCGATGAAAGAGGATGATAAGCAATAT
GCATAATTTAAGTAAACTTAAAGAGATAACAATATTATGAGCTAAAAGCAAGTATTACCA
TCAATAACAAAAAAATTTCTTATAGATAATGGAGCAAATTCAAATTCACCCACATCTAGG
ACTGCTAAGCTTTCTCTGGGATCGACTTCTCAGTTCACTAAATAAACAAATGGATAATTC
ATAAACCCGAGCGGAAGTACTACAAATGCAAATAGTACTTCGAGACTAGTGAACGATATG
AACTTCTCAAAATTTCATAACCTTAATGTTATTTACAATACTAATACTTATAATTACAAC
ATGCCTCTTACTTAAAAAGCAGCAAACAACACTAAAAAAACAAAACCTAAATACTAAATT
TGA


>TTHERM_00717780(gene)
ATGAATAAATATGAAATTTTAGGTGTAAATGGCGAGGGAGCTTATGGAGTTGTTTTGAAA
TGCAGAAATAAAGAAACCTAAGAAATAGGTAAAGATTTATCTAAGTTTAATTTAATTGCA
AATCATCATTATGATTTACTAAGTTTAATAAATGCTAACTTATTTTTGTTAGATTACTAA
TGTCATATTTATAATTTTTAAACGTATTTACTAAAAACAAGATAAAAATTTAGCATTTTT
AATAATTTTAAAAAGTTGCCATCAAAAAATTCAAAGAGACTGAAGATGATGAAATAGCTA
AAAAAAATATATAAAGAGAAGTTAAAATGCTTAGATAGCTACGCCATAAAAATATTGTAG
ACTTGATAGAAGCTTTTAAAAGGTAAAATAATTTATATTAATTATTTAACTAATTACATG
AAAGCAGAGTATAGAAAAGCATTAAGCTCCAATCAAAATTAAAAATATTCACTTTCTTCT
AAGTATTTGTATTAAAAATGATACTAAATTCTTATTTTTAAGAAAAGGGAGAATTTATTT
AGTATTTGAATATGTAGAAAAAAATCTCTTAGAAGTTTTAGAAGAAAAACCAACTGGCTT
AGATGTAATAAATTGAGTTTAAATGAATCTTAATTTTTGATTTGTTATGTAACTTAAAAA
TGCTTTTTTAACGTTGAAATTGCTAGCGAATATTTAATTAATAGATAAATAAATAAAGAT
TTTATTTATTTTAAAACCTTTTGAAAAAAAAAGATGAAAGAATAGTTGTAAATTAATCTG
TCATATATAAATAAATATACATACATAGAGCTCATATAGAAAATTTATTTAAATGAAAGG
GGAAAAAATAAATATTAGATTTTATTAGAAAATTATTAATTTGTTTTAAAGAAATTCAAC
ATTTTCAAGAATTATACTTCCTTCTAGCAAACATAATAACTATGAGCTAGCTTATCTCCT
TGTTCTAGCTAATATAAATAATTACTAAATCAACTTATTCTTTTAATAAAATTTCTTTCT
ATTTTGGCATTAAAACAAATTTAGAAATATAATTAATTATGGTATTTGTAGAAAAATAAA
AATTACATTTGTTAACTAAAAAATTTAAGCAAACTTTCAAGATTCAAAAGAACAAAACAA
TATTATTTAAAACTGAATAAAAATCAATCAATAGTTAATCAAATATCATTTTTTTAACAA
AAGCATGAAGTTATTAGAATTATCATGTATTAACTGCTTAAGGCTCTTCATTAATGTCAT
AAATAAGATGTGATACATAGAGATGTAAAGCCAGAGAACTTATTGGTTAATCCTTATAAT
TATGAGTTAAAATTATGTGATTTCGGTTTTGCTAGAACTTTGCCTTCTAAGTAAGGAGAA
ATTATAACTGACTATGTGGCTACAAGATGGTATAGAGCCCCAGAATTACTTTTAAAATAT
CCTAAATATAGTAAACCTGTTGATATTTGGGCAGTAGCCTGCATTATGGGTGAATTAATT
GATGGATAACCCCTTTTTCCAGGATAGAATGAAATAGATCAACTCTATTTGATATAGAAA
ACTCTTGGCCCGCTCACTCCTGAATAAAAAGAATTATTTATTAAAAACCCTCGTTTCATT
GGAACAAAGTTTCCTGAAATAAATAAACCAGAAACTATTGAAAGAAGATATCTAGGGAAG
TTAAGTAAAAAAGCATTAAATATCATGAAGGTATTATTTTCATTTAAGCATTAAATACTT
GTTCAAACCAAATTAATTTTGATTCTTTTATTTTAAAATTCTCTAAATAAATTCAAATTT
TTATTAGATTAGATGAAATTACTAATCATTTTTTTTGAAAAAAACTAAAAATATATTTTA
TTTTTTTTCATTAGTTAATGCTAAAAATGGACCCTGATGAGAGAATAACTGCTGAGGAAG
CGATGAAACATCCTTATTTTGATGGAGTCAGAGAGTAATTTGATAAAGACGATAATGTTA
CTAAACCAGTAAGTGCAGTTACAATAGATTTAAAGAGAGAAAATTCTCATCTAAAGAAAA
TGCCTTAAACTGATAAGTAAATAAATCTTTCTAGAAAAGTTGATATTATTGGGTAAAATT
AAAACTAACTTATTTTTAAATGATAAAAATTCTCCTTTCTAGAAAAACTGAATCGAATGA
TATTGATGAAAAAAACAATGGTATGGTTTAAAATAACGAAGATCACAACGAGTATGGAGA
ATCTTATGGAAAACAATCAATGAAGCTTGAAAAAGTAATTCTTTTAACTTGCTTAATATT
TATTTATAATATTTTTCCCTTTAAAAATTATTCAAATTTATTATCAAATATATCAAAATT
TTATTTGTATTTTTTATAAAAAATTAAGTCAACTAAACTATTTGGGCAAAAATCAATTCC
TACATATTTATAAGGGTAGTAATTTATGTAAAGTTCAGTTTATAATTACAAAGTATCAGA
TAAAAATCTTGAGGAAGGATCCTTTATAGACCAAGATAAAAATTTGAAAGTAAATTTTTG
TATGTATTCAAAGCATATTTAATATAATTTGTTAGAAGAATAATTAAGATAAAAGCTTGG
AAAAGAAGACAGCAGCAGTAATACCTGCTCAAGTTGGAGACCAAATTAAAAAAATTCCTT
TGAAAAAAAATTTAGTAAAATTAATTGATAAAATGATTTTATTTTAATTCGTTGTTATTA
AATTAAAAAAAAGAGCTTAAACAAAATACATAAGACATTTTACTAATCAGTAGGTAAAAA
TAAATTAAATTAAAAAATTTTGATCTAACTAACTCACTAACAAACAAACATATTTATTTA
TTTTTTTATTTATTCGACAAAGCGATGAAAGAGGATGATAAGCAATATGCATAATTTAAG
TAAACTTAAAGAGATAACAATATTATGAGCTAAAAGCAAGTATTACCATCAATAACAAAA
AAATTTCTTATAGATGTACAAATAATTAAAATATACGCTCAATTAACAAATTTTTTTTAT
TAAAGAATGGAGCAAATTCAAATTCACCCACATCTAGGACTGCTAAGCTTTCTCTGGGAT
CGACTTCTCAGTTCACTAAATAAACAAATGTATCAATTTTTATATTAATTATTTGATTCA
TCATAACACATATTAATATTAAAAATTAAAGGGATAATTCATAAACCCGAGCGGAAGTAC
TACAAATGCAAATAGTACTTCGAGACTAGTGAACGATATGAACTTCTCAAAATTTCATAA
CCTTAATGTTATTTACAATACTAATACTTATAATTACAACATGCCTCTTACTTAAAAAGC
AGCAAACAACACTAAAAAAACAAAACCTAAATACTAAATTTGA


>TTHERM_00717780(protein)
MNKYEILGVNGEGAYGVVLKCRNKETQEIVAIKKFKETEDDEIAKKNIQREVKMLRQLRH
KNIVDLIEAFKRKGRIYLVFEYVEKNLLEVLEEKPTGLDHEVIRIIMYQLLKALHQCHKQ
DVIHRDVKPENLLVNPYNYELKLCDFGFARTLPSKQGEIITDYVATRWYRAPELLLKYPK
YSKPVDIWAVACIMGELIDGQPLFPGQNEIDQLYLIQKTLGPLTPEQKELFIKNPRFIGT
KFPEINKPETIERRYLGKLSKKALNIMKLMLKMDPDERITAEEAMKHPYFDGVREQFDKD
DNVTKPVSAVTIDLKRENSHLKKMPQTDKQINLSRKVDIIGKTESNDIDEKNNGMVQNNE
DHNEYGESYGKQSMKLEKSTKLFGQKSIPTYLQGQQFMQSSVYNYKVSDKNLEEGSFIDQ
DKNLKKNNQDKSLEKKTAAVIPAQVGDQIKKIPLKKNLSLNKIHKTFYQSVAMKEDDKQY
AQFKQTQRDNNIMSQKQVLPSITKKFLIDNGANSNSPTSRTAKLSLGSTSQFTKQTNGQF
INPSGSTTNANSTSRLVNDMNFSKFHNLNVIYNTNTYNYNMPLTQKAANNTKKTKPKYQI