Identifiers and Description

Gene Model Identifier

TTHERM_00721400

Standard Name

NRK3 (NIMA-Related Kinase)

Aliases

PreTt18448 | 115.m00104

Description

NRK3 plant dual-specificity MAP kinase kinase family domain protein; NIMA-Related Kinase- Protein kinase domain containing protein. Sequence similarity to the NEK protein kinase family (Eisen et al.- 2006).

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17477.1 9.997093137033517e-262
Description: protein kinase domain-containing protein (499 aa)
Oxytricha Contig16193.0.g77 6.999576669079256e-104
Description: Protein kinase domain
DictyBase DDB_G0270814 4.998338612125368e-60
Description: nek2 on chromosome: 1 position 4847143 to 4848761
WormBase WBGene00008956 5.00115835552873e-49
Description: locus:nekl-3 status:Confirmed UniProt:G5EFM9 protein_id:CAA92169.2
Stentor Coeruleus SteCoe_34801 2.506567475899953e-46
Description: None
SGD YAR018C 1.0002335610448659e-38
Description: KIN3 Nonessential serine/threonine protein kinase; possible role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00721400(coding)
ATGAGTTCAGTTTCATTGAGCGATTTCAACGTTTAAAAAACTTTAGGAAATGGAGCATTT
TCATGGGTATATAAAGTATAGCGCAAACAAGATGGCTAAGTTTACGCTCTTAAAAAGGTT
AAATTGAGGGAACTCTCTTACAAAGAGAAAGAAAATGCTTTAAACGAAATCAGAATTTTA
GCTTCAATAAACTCTCCTCACATTATCAGATACAAAGATGCATTTTATGATAATGCAAGC
GGATGTCTTTGCATTGTGATGGAATATGCAGAGAACGGCGATTTAATGGCTAAATTGCAA
GATTATAAAAAAAGAAACATGTTTATGGACGAGGCAAAAATTTGGAAATATGCAGCATAG
ATTTTACTGGGTTTAAAATCATTGCATGATCTGAAAATTCTTCATCGTGACTTAAAGTGT
GCAAATATTTTCTTGGGTGCTAATAATAAAGTAAAGTTAGGGGATTTAAATGTCTCTAAA
ATTATGAAGAGAGACCTAGCTTACACTCAAACTGGAACACCTTATTACACATCCCCTGAA
GTTTGGTAAAATCAACCATATGATTCAAAGTGTGATGTTTGGAGCATGGGATGTGTTCTA
TATGAATTGATGGCTCATCATCCTCCATTCGAAGCTAAATCCATGGAGGAACTCTATAAG
AAAGTATGTAAAGGCACCTATTAAAAGCTTCCCAAGTAATATAGCCAAGAAATGAATGAC
TTTATTAATCTTTGCTTGAGAAAAAACCCTAAATAACGTCCTTCTGTGAATTCTCTACTA
GAGTTTTAGGGCCTATTGCCTTACGTTTAAAATATATTGGAGAATGAAGAAGATAAAGAA
AATAAGCAACCCAATATTTAGAAAAATAACTCTTTGAATCTTCTATAGACAATGAAAATG
CCTTATGGAAATCTAAATGCTTTAAAAAACATTTTGCCTAAAGCTTAATTTGAAGATTCA
ATAGATTCCTTTATGGAAGAGTAGTCTTTAGCAAAGAAGTCATCTGGAAATAGACCAATC
TCAGCTGTAAACAATAACGATTTTAAAAACAACATTAACTAAAGACATTCACTTGAGCCT
CAACAAGGAAAGTAATAAAATCAATAGCCTAGCTCAAATATTTAAAGACATGCATAGTCT
CCTCCTTCTCATTCTAATTAATAAATTTTGAGCAGTAGACAAAGAATACAATCTGCTCAT
AACGCAATACTATGCCGTTAAGACTCAAATTCCTCAGTTTAAAATTAACTAAAATCCAAT
AATAATAACGTACCAAACGGAATTAATAATTGCCCTTTACCAAAAAGTCCTGAAATTTTA
GGTAGCAAAAAAATATCTGCCTTATAACGTAATGGAATTGAAATGGTTAAGCCCAGAAAT
TCCATCGAAGAAGGAATACCATTAAGAAACGATAGAGAGAGAGGAAGTGTAAATATTCCT
GTAAATAATAACAGATACCCCTCAGCAGGAAGAAGAAACATTTTATGCTGA


>TTHERM_00721400(gene)
ATGAGTTCAGTTTCATTGAGCGATTTCAACGTTTAAAAAACTTTAGGAAATGGAGCATTT
TCATGGGTATATAAAGTATAGCGCAAACAAGATGGCTAAGTTTACGCTCTTAAAAAGGTT
AAATTGAGGGAACTCTCTTACAAAGAGAAAGAAAATGCTTTAAACGAAATCAGAATTTTA
GCTTCAATAAACTCTCCTCACATTATCAGATACAAAGATGCATTTTATGATAATGCAAGC
GGATGTCTTTGCATTGTGATGGAATATGCAGAGAACGGCGATTTAATGGCTAAATTGCAA
GATTATAAAAAAAGAAACATGTTTATGGACGAGGCAAAAATTTGGAAATATGCAGCATAG
ATTTTACTGGGTTTAAAATCATTGCATGATCTGAAAATTCTTCATCGTGACTTAAAGTGT
GCAAATATTTTCTTGGGTGCTAATAATAAAGTAAAGTTAGGGGATTTAAATGTCTCTAAA
ATTATGAAGAGAGACCTAGCTTACACTCAAACTGGAACACCTTATTACACATCCCCTGAA
GTTTGGTAAAATCAACCATATGATTCAAAGTGTGATGTTTGGAGCATGGGATGTGTTCTA
TATGAATTGATGGCTCATCATCCTCCATTCGAAGCTAAATCCATGGAGGAACTCTATAAG
AAAGTATGTAAAGGCACCTATTAAAAGCTTCCCAAGTAATATAGCCAAGAAATGAATGAC
TTTATTAATCTTTGCTTGAGAAAAAACCCTAAATAACGTCCTTCTGTGAATTCTCTACTA
GAGTTTTAGGGCCTATTGCCTTACGTTTAAAATATATTGGAGAATGAAGAAGATAAAGAA
AATAAGCAACCCAATATTTAGAAAAATAACTCTTTGAATCTTCTATAGACAATGAAAATG
CCTTATGGAAATCTAAATGCTTTAAAAAACATTTTGCCTAAAGCTTAATTTGAAGATTCA
ATAGATTCCTTTATGGAAGAGTAGTCTTTAGCAAAGAAGTCATCTGGAAATAGACCAATC
TCAGCTGTAAACAATAACGATTTTAAAAACAACATTAACTAAAGACATTCACTTGAGCCT
CAACAAGGAAAGTAATAAAATCAATAGCCTAGCTCAAATATTTAAAGACATGCATAGTCT
CCTCCTTCTCATTCTAATTAATAAATTTTGAGCAGTAGACAAAGAATACAATCTGCTCAT
AACGCAATACTATGCCGTTAAGACTCAAATTCCTCAGTTTAAAATTAACTAAAATCCAAT
AATAATAACGTACCAAACGGAATTAATAATTGCCCTTTACCAAAAAGTCCTGAAATTTTA
GGTAGCAAAAAAATATCTGCCTTATAACGTAATGGAATTGAAATGGTTAAGCCCAGAAAT
TCCATCGAAGAAGGAATACCATTAAGAAACGATAGAGAGAGAGGAAGTGTAAATATTCCT
GTAAATAATAACAGATACCCCTCAGCAGGAAGAAGAAACATTTTATGCTGA


>TTHERM_00721400(protein)
MSSVSLSDFNVQKTLGNGAFSWVYKVQRKQDGQVYALKKVKLRELSYKEKENALNEIRIL
ASINSPHIIRYKDAFYDNASGCLCIVMEYAENGDLMAKLQDYKKRNMFMDEAKIWKYAAQ
ILLGLKSLHDLKILHRDLKCANIFLGANNKVKLGDLNVSKIMKRDLAYTQTGTPYYTSPE
VWQNQPYDSKCDVWSMGCVLYELMAHHPPFEAKSMEELYKKVCKGTYQKLPKQYSQEMND
FINLCLRKNPKQRPSVNSLLEFQGLLPYVQNILENEEDKENKQPNIQKNNSLNLLQTMKM
PYGNLNALKNILPKAQFEDSIDSFMEEQSLAKKSSGNRPISAVNNNDFKNNINQRHSLEP
QQGKQQNQQPSSNIQRHAQSPPSHSNQQILSSRQRIQSAHNAILCRQDSNSSVQNQLKSN
NNNVPNGINNCPLPKSPEILGSKKISALQRNGIEMVKPRNSIEEGIPLRNDRERGSVNIP
VNNNRYPSAGRRNILC