Identifiers and Description

Gene Model Identifier

TTHERM_00723090

Standard Name

TGL1 (TriGlyceride Lipase 1)

Aliases

PreTt18069 | 116.m00094 | 3671.m00018

Description

TGL1 Ab-hydrolase associated lipase region protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00561 ) hydrolase, alpha/beta fold family
  • ( PF03810 ) Importin-beta N-terminal domain
  • ( PF04083 ) ab-hydrolase associated lipase region
  • ( PF06021 ) Aralkyl acyl-CoA:amino acid N-acyltransferase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14788.1 9.997093137033517e-262
Description: ab-hydrolase associated lipase region family protein (451 aa)
DictyBase DDB_G0276083 5.001742359316081e-68
Description: lip4 on chromosome: 2 position 6415536 to 6416900
Oxytricha Contig17503.0.g2 2.0002571866765887e-62
Description: Partial alpha/beta-hydrolase lipase region
WormBase WBGene00021963 3.000235161122315e-61
Description: locus:lipl-6 status:Partially_confirmed UniProt:E2S7J2 protein_id:CCD72909.1
SGD YKL140W 1.9991939848149086e-44
Description: TGL1 Steryl ester hydrolase, one of three gene products (Yeh1p, Yeh2p, Tgl1p) responsible for steryl ester hydrolase activity and involved in sterol homeostasis; localized to lipid particle membranes
Stentor Coeruleus SteCoe_29520 1.185064864233981e-27
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00723090(coding)
ATGAGTGACCCTATTCTAGCATAATTTAAAGAGGCGCTTAGGATATCTCTACTATATTTT
ATTCATTTTGCAGTTTTCATCCAGTGTTTCCTCATGTCCACTCTTCTTTATATCTTAAGA
ATAATTCTACACCTTTTCACAGCAATCCCTCAATTAAAACACTTGAGAAAATCTTTGATG
AGATTTTTACCTTAAATCAATCCTGATGTTTATGCTAAAGCAGAGGATTTAATTATGAGT
CACATTGAATACAACATTGAAACTCATAAAATTCTCACTGAAGATGGTTACTATTTAACA
GCCTGGCGTATTCTTTCTTCAGATAAGAAGAAATCTTAAGAAGCTCGCAGCAAAGCTCCC
GTCATTTTGATGCATGGACTTTTAGATTGCAGTTTTTCTTGGTTTGTTAATAAAGAAAGA
TAGATGTGCTTGCCTTATATTTTGGCAGACTAGGGCTATGACGTTTGGTGCATGAATAAC
CGCGGTAATAGATACTCCTTAGGTCATAAGTACTTCAAACATATTAAATCAAATCCTCAT
TATTGGAACTATGGCTTTGATGAGCTAGCAAAATATGACGTTAAAGCTAATGTCTAATAT
GTTTTAGACACTACAAGCCACTCAAAAGTGTTTTATGTAGGCCACTCTTAAGGCTCTACT
TAAATGTTTGCAAAATTAATGGAAGATCCTTAATTCTAAGAAAAAATTAAAGCTTTCATT
GCTCTCGGTCCAGCTATTTATATTTAAAACTTGGCAAGCAATTTCGTAAAGAAAATGTTT
GGATGTGGTTTCTATCAACTTTTAGATAAATTGGGATACAGAAACTTCTTAGTGCTACCT
AAATCCATTTCTAGAAGAGTTGGAGCACTGTGCCACTATTTACCATTTTTATATGATATC
GGTCTATTTAAAGTTATGAATTTACTTTGCGGCTTCCCTGTTGAAAATAAAATTCCTCGT
GACAAAATTTCAGTTATTGTAACACACGAACCTGGTGGTGCTTCAGTTAGAAATATTTTA
TAATGGGAACAATTCATGAAATCTGGAGAGTTTAAAAAGTTTGATTTTGGAGCTTAAAAG
AATATGAAGGTATATGGATAAACAAAACCTCCTTGCTATAATACAGAGAATCTTAAAAAG
ATAACAATTCCTCAACACTTGTTTATTGGTACTTCAGATATTGTTGGAAATAAAATAGAT
ACTGATCGCTTACTATAACTAGTTAATCCTGATTCTTCCAAGATATATACGCTAAATGAC
TATGCCCATCTTGACTATGTATGGGGAACTGATGCTAACACTGTACTTTACCCCTAAATA
ATAAAAATATTAAAAGCTCACCAAACAACATGA


>TTHERM_00723090(gene)
ATGAGTGACCCTATTCTAGCATAATTTAAAGAGGCGCTTAGGATATCTCTACTATATTTT
ATTCATTTTGCAGTTTTCATCCAGTGTTTCCTCATGTCCACTCTTCTTTATATCTTAAGA
ATAATTCTACACCTTTTCACAGCAATCCCTCAATTAAAACACTTGAGAAAATCTTTGATG
AGATTTTTACCTTAAATCAATCCTGATGTTTATGCTAAAGCAGGTATATAACTTAATACA
TATTTTTTAACGAGTTCGCAGCTTCAAATTAGCGACTCAAAAATTTTTTTGGAATTTAAT
CAAACTATTTTTCTATTTTATAGAGGATTTAATTATGAGTCACATTGAATACAACATTGA
AACTCATAAAATTCTCACTGAAGATGGTTACTATTTAACAGCCTGGCGTATTCTTTCTTC
AGATAAGAAGAAATCTTAAGAAGCTCGCAGCAAAGCTCCCGTCATTTTGATGCATGGACT
TTTAGATTGCAGTTTTTCTTGGTTTGTTAATAAAGAAAGATAGATGTGCTTGCCTTATAT
TTTGGCAGACTAGGGCTATGACGTTTGGTGCATGAATAACCGCGGTAATAGATACTCCTT
AGGTCATAAGTACTTCAAACATATTAAATCAAATCCTCATTATTGGAACTATGGCTTTGA
TGAGCTAGCAAAATATGACGTTAAAGCTAATGTCTAATATGTTTTAGACACTACAAGCCA
CTCAAAAGTGTTTTATGTAGGCCACTCTTAAGGCTCTACTTAAATGTTTGCAAAATTAAT
GGAAGATCCTTAATTCTAAGAAAAAATTAAAGCTTTCATTGCTCTCGGTCCAGCTATTTA
TATTTAAAACTTGGTAATTATTTATTTCTCAACATTTTTGAACATCTTAATAAAAAAAAA
TATTAATACAAAATGAATACTTTGCTTGCTTTAGAAAAAGCAAAATTTAGAGCAATAAAA
AACTAAATATAATTAATTACTATTAAAATAAAATTAATCAATTTATATTAAATTTTATTA
TGAACTTTAATACAGCTAAAATTCTTTTTTAAAAGAATTTAAAATTGAATTAATTAGAGA
GAGTCATTTTTAATAAGAAATAATACTTTTAATCAAATGAAATATGATATAATTAATAAT
AGCAAGCATTAATTCATTACATTAAACTATATTTATTGAGAAAATATTAAATTAATATTT
ATTTTTTTATGAATAGGCAAGCAATTTCGTAAAGAAAATGTTTGGATGTGGTTTCTATCA
ACTTTTAGATAAATTGGGATACAGAAACTTCTTAGTGCTACCTAAATCCATTTCTAGAAG
AGTTGGAGCACTGTGCCACTATTTACCATTTTTATATGATATCGGTCTATTTAAAGTTAT
GAATTTACTTTGCGGCTTCCCTGTTGAAAATAAAATTCCTCGTGACAAAATTTCAGTTAT
TGTAACACACGAACCTGGTGGTGCTTCAGTTAGAAATATTTTATAATGGTAATTTACTTA
CTCTTATATTTGAAATAATAAATTTATTTAATATTGAATATTCTAAAATTTAATTTTAAT
CATTAGGGAACAATTCATGAAATCTGGAGAGTTTAAAAAGTTTGATTTTGGAGCTTAAAA
GAATATGAAGGTATATGGATAAACAAAACCTCCTTGCTATAATACAGAGAATCTTAAAAA
GATAACAATTCCTCAACACTTGTTTATTGGTACTTCAGATATTGTTGGAAATAAAATAGA
TACTGATCGCTTACTATAACTAGTTAATCCTGATTCTTCCAAGATATATACGCTAAATGA
CTATGCCCATCTTGACTATGTATGGGGAACTGATGCTAACACTGTACTTTACCCCTAAAT
AATAAAAATATTAAAAGCTCACCAAACAACATGA


>TTHERM_00723090(protein)
MSDPILAQFKEALRISLLYFIHFAVFIQCFLMSTLLYILRIILHLFTAIPQLKHLRKSLM
RFLPQINPDVYAKAEDLIMSHIEYNIETHKILTEDGYYLTAWRILSSDKKKSQEARSKAP
VILMHGLLDCSFSWFVNKERQMCLPYILADQGYDVWCMNNRGNRYSLGHKYFKHIKSNPH
YWNYGFDELAKYDVKANVQYVLDTTSHSKVFYVGHSQGSTQMFAKLMEDPQFQEKIKAFI
ALGPAIYIQNLASNFVKKMFGCGFYQLLDKLGYRNFLVLPKSISRRVGALCHYLPFLYDI
GLFKVMNLLCGFPVENKIPRDKISVIVTHEPGGASVRNILQWEQFMKSGEFKKFDFGAQK
NMKVYGQTKPPCYNTENLKKITIPQHLFIGTSDIVGNKIDTDRLLQLVNPDSSKIYTLND
YAHLDYVWGTDANTVLYPQIIKILKAHQTT