Identifiers and Description

Gene Model Identifier

TTHERM_00723170

Standard Name

RAB36 (RAB GTPase 36)

Aliases

PreTt18077 | 116.m00102 | 3671.m00026

Description

RAB36 small guanosine triphosphatase family Ras family protein; Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14793.1 2.9990203769197855e-115
Description: Ras family protein (224 aa)
SGD YFL038C 1.9993430003514377e-39
Description: YPT1 Rab family GTPase, involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by protein geranylgeranyltransferase type II (Bet2p-Bet4p)
DictyBase DDB_G0280043 8.003017249547689e-39
Description: rab8A on chromosome: 3 position 3266503 to 3267523
Oxytricha Contig22392.0.g29 4.998978211117678e-38
Description: Ras family
WormBase WBGene00004266 9.99648502569394e-38
Description: locus:rab-1 status:Confirmed UniProt:Q9UAQ6 protein_id:CCD67094.1
Stentor Coeruleus SteCoe_24985 2.1151310375910805e-19
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00723170(coding)
ATGGCAGCATTATAAAAAAAGCAATCCATAAACTGTAAAGTGTTAGTTTTAGGTAAATCA
GGAGTTGGAAAGAGTTATATTCTTCTTTAATATACAGCTCCTCCTCAAGAAATAGTCTAG
ATGCCAAAATTAACAACAGTTGGTGTAGATTATAAATATGGGACTGAAAAGATTGAAGAT
ACAGAAGTTAAAATGTCAATATGGGATACTGCTGGCCAAGAGAAATATCGCCCTATTATT
TAGACTTATTTTAAGAATTCAAAGGCAGCAATTCTTGTGTTTGATTTAACAGATAAGTAA
TCCTTGTAAGATGTGAGATACTGGCTAAGAGAAGTAAAATTGTAATGTGGTAAGGATGTA
GCAAAAATTTTAGTAGGAAATAAATGTGATTTGCCTCACGAATAGCCTGATTAAGCTTTG
ATATAAGAATATTGCGAAGAATTTCAAATGGAATATATAGAATCAAGTGCTTTATAAAAG
ATTAATATTTAAGAAATATTTGTAAAGTTAGCTAAAAAGATATATTAATAGCACAAAGCA
AGTATTCCATAAAATCAATTAAAATAAAATAGTTTACCAGCAAATGAAGCTTAAAATTAA
AATTCTACATCATCAAATAAATAAATAAGTTTAAAAAATTCTAAACCAAAATAGAAAAAA
GAAAATGATGGGTGTTGCTGA


>TTHERM_00723170(gene)
ATGGCAGCATTATAAAAAAAGCAATCCATAAACTGTAAAGTGTTAGTTTTAGGTAAATCA
GGAGTTGGAAAGAGTTATATTCTTCTTTAATATACAGCTCCTCCTCAAGAAATAGTCTAG
ATGCCAAAATTAACAAGTAAAATTTGAAAATTTAAAATGATTATTTATAAAATGGAAATC
TGAGATAATCAGATTAAACTGTAAAATAATAATTTTTAATTTCTTTTTTCCATAATTAAA
AAAATTACCATCTAATTGAAAAATTAAGCTATTTTTATAATAAGCAGTTGGTGTAGATTA
TAAATATGGGACTGAAAAGATTGAAGATACAGAAGTTAAAATGTCAATATGGGATACTGC
TGGCCAAGAGAAATATCGCCCTATTATTTAGACTTATTTTAAGAATTCAAAGGCAGCAAT
TCTTGTGTTTGATTTAACAGATAAGTAATCCTTGTAAGATGTGAGATACTGGCTAAGAGA
AGTAAAATTGTAATGTGGTAAGGATGTAGCAAAAATTTTAGTAGGAAATAAATGTGATTT
GCCTCACGAATAGCCTGATTAAGCTTTGATATAAGAATATTGCGAAGAATTTCAAATGGA
ATATATAGAATCAAGTGCTTTATAAAAGATTAATATTTAAGAAATATTTGTAAAGTTAGC
TAAAAAGATATATTAATAGCACAAAGCAAGTATTCCATAAAATCAATTAAAATAAAATAG
TTTACCAGCAAATGAAGCTTAAAATTAAAATTCTACATCATCAAATAAATAAATAAGTTT
AAAAAATTCTAAACCAAAATAGAAAAAAGAAAATGATGGGTGTTGCTGA


>TTHERM_00723170(protein)
MAALQKKQSINCKVLVLGKSGVGKSYILLQYTAPPQEIVQMPKLTTVGVDYKYGTEKIED
TEVKMSIWDTAGQEKYRPIIQTYFKNSKAAILVFDLTDKQSLQDVRYWLREVKLQCGKDV
AKILVGNKCDLPHEQPDQALIQEYCEEFQMEYIESSALQKINIQEIFVKLAKKIYQQHKA
SIPQNQLKQNSLPANEAQNQNSTSSNKQISLKNSKPKQKKENDGCC