Identifiers and Description

Gene Model Identifier

TTHERM_00725930

Standard Name

DRH42 (DExD/H box RNA helicase 42)

Aliases

PreTt21859 | 117.m00111

Description

DRH42 helicase carboxy-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF03107 ) DC1 domain
  • ( PF03202 ) Putative mycoplasma lipoprotein, C-terminal region
  • ( PF04297 ) Putative helix-turn-helix protein, YlxM /
  • ( TIGR01587 ) CRISPR-associated helicase Cas3

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04583.1 9.997093137033517e-262
Description: helicase domain-containing protein (738 aa)
Oxytricha Contig13621.0.g36 2.9999146385131704e-95
Description: Mitochondrial degradasome RNA helicase subunit C terminal
DictyBase DDB_G0278937 3.0011595823640496e-94
Description: DDB_G0278937 on chromosome: 3 position 1214678 to 1217558
WormBase WBGene00007444 2.0001503375893664e-79
Description: ATP-dependent RNA helicase SUV3 homolog, mitochondrial status:Partially_confirmed UniProt:Q17828 protein_id:CAJ43433.1
SGD YPL029W 2.999564368270328e-76
Description: SUV3 ATP-dependent RNA helicase, component of the mitochondrial degradosome along with the RNase Dss1p; the degradosome associates with the ribosome and mediates RNA turnover; also required during splicing of the COX1 AI5_beta intron
Stentor Coeruleus SteCoe_20130 1.368539471173853e-44
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00725930(coding)
ATGATTAAGTAGAGAAGATTTATTTTTTACTAAGCTGATATTATTGCTAAGTAATTAATT
TAAAGATAATCATGTATGAATATTAGTATGTTGAATTTAATGGCTATCTAATAGTCATCT
AGTTTATTGCATCAAAAGTCTAAAACGAGGCAAAGGAGCTTATTTTTCTAGAATGTTTGC
AGTTTTACAGATATTGCAGGAACATAACCTCACTAAAATAAAAAAAAAAATGTAAAAAGT
AGTTAAAGTGAGAGCGAGGAAGAGGAAGTAAATATCAGAAAAAAAGAGGACAAAAAAAAA
GATTAAACTGATGCATACCATCTCATTTAAAAGATTTAACACTCTGTGCCTAATATAAGA
TCAAGATATTATAGTATGTATGATACATTTTAAAATATCTATATTGAAGATAATGTTTAG
TTCTTTAAGGAAGCAAGATTTAAATTTAAGATAAATGATATTGCTATTTTTTGTTACTTT
AGCTTGAGGGAAATCTAAGATATGTATAAGAAGGAGCATAAAATTCTTTCATTTATGATG
GAGGATAAAATTATATAGCGTTTTCGTAGCCACTTTGATAAGAACAAAAGATTCTAGAAA
ATATTCTCAAATTACTTTGAGTTACCAATAAATGAAAGATACGAGTTAGTTGCTTAAAAA
TTTGGTCATAGCAACACACAATTTTATTTGGATTTTTATCCTCTATACGATTTGTTTTTC
GCTTTTGCAGCCTAAAATTTAGGAAAAAAATATGAAGAGTCTATTGAAATTTATAATTTA
TTACAAATTGAGGAGCCTCATCATTTATATCAGGATACTCGTAAAATGAAAAGAAAAATT
ATTTATCATTATGGTCCAACAAATTCTGGAAAAACACACTCAGCTTTAGAAACTTTGATG
AGTGCTAAATCTGGAATATACTGTGGTCCACTCAGACTTTTGGCTAGAGAAATTTATTAA
AAATTTAAGTAAAGAGGGTTAAACTGTAATTTAATTACAGGTTAAGAAAAATTAATAGAG
CCTGATTCATAGTTCTACTCTTGTACCACTGAAATAGGATGCTAAAAAATTGATTTGGAT
TTTGATTGTGCTGTTATTGATGAAATATAGTATTTAGGTGATTAAGAGAGAGGTGCTGCA
TGGACTAAAGCTTTTTTAGGTCTTAAGGCTAAGGAAATACATGTCTGTGGCGATGGAAGA
GCACTATAATTAGTAGAGAACATGTGTAAACAAGTTGGTGATTAATTTGAAACAGTCAAA
TATGAAAGAATGAGTTAATTAACTGTTGAAGATAAGCCATTTGAACTTCAAGATTTGCAA
GAAGGAGACTGCTTGATTTGCTTTAGCGTTAATGAGGCTATTTCTTTCAAAAGAATTGTT
AACAATTATATTAACTCTAAAAATCCTGATAATCCTTAGAGTTAAGAAAATTAATGTAGT
ATTATTTATGGTAGATAGCCAGCTGAAATTAAAAAAGAATAAGCTGAACTATTTAATAAT
AGGACACATAAGTATCTTGTTGCTACAAATGCAATAGGTCTTGGACTTAATTTAAATATA
AGAAGAGTAGTTTTCACAACATTTACTAAGAATCATTAAAGTTAAAGAAAAGGTATAGAT
TCGAATGAAATACTTTAGATTGCTGGAAGAGCTGGGAGATATAGGGAAGATGGATTAGTA
ACAGCAAGAAATGTAAAATAGATAAAAATACTAAAAGAAACTCTACAAAAAAGGGATTAA
CTCATATAATAGTAAACCATTTAAAAAGCTGCTTTCTTCCCAACATATGAGCAGATTGAA
GGTTTTAGAGATTGGCTAAGCTAAGGAAAGAAAAAAAAATAGATAAAACTAAGTGAAGTC
TTTCAAAAGTTTGTAAATTATTCTACATTACAAGGAGCCTATTTTATAGAAAATGAAAGA
GAATTTTGTCATAAGGCAGACCTAATTGAAGATTATGGATTGTCTCTTAGTGATTAATTT
ACATTTAGTTAAGCTCCTATGAGATTTGGAAAAGTTTTTGAAAAAGAGAGGGAACTATTC
TAGCTATTTGCTTAAAAATATGCTATGGGATAGGAAATTGCTTTACCAAATCTTTTAAAA
GATGATGATAAAATCAAGAATATTAAATAGCAATAATAAGCCAATAAAGATTCGCTAACA
ATTTATGAATCTCTGTATTACATTTTAGAATTATATATATGGCTTGGGAATAAATTTGGT
GAAGATAGATTCCCTGATATGCAATTAGCTCACAACAAAAAGTCAGTGATTTGTAGTATG
ATGAATGAAATACATTCACATAACTAATATCAATGA


>TTHERM_00725930(gene)
ATGATTAAGTAGAGAAGATTTATTTTTTACTAAGCTGATATTATTGCTAAGTAATTAATT
TAAAGATAATCATGTATGAATATTAGTATGTTGAATTTAATGGCTATCTAATAGTCATCT
AGTTTATTGCATCAAAAGTCTAAAACGAGGCAAAGGAGCTTATTTTTCTAGAATGTTTGC
AGTTTTACAGATATTGCAGGAACATAACCTCACTAAAATAAAAAAAAAAATGTAAAAAGT
AGTTAAAGTGAGAGCGAGGAAGAGGAAGTAAATATCAGAAAAAAAGAGGACAAAAAAAAA
GATTAAACTGATGCATACCATCTCATTTAAAAGATTTAACACTCTGTGCCTAATATAAGA
TCAAGATATTATAGTATGTATGATACATTTTAAAATATCTATATTGAAGATAATGTTTAG
TTCTTTAAGGAAGCAAGATTTAAATTTAAGATAAATGATATTGCTATTTTTTGTTACTTT
AGCTTGAGGGAAATCTAAGATATGTATAAGAAGGAGCATAAAATTCTTTCATTTATGATG
GAGGATAAAATTATATAGCGTTTTCGTAGCCACTTTGATAAGAACAAAAGATTCTAGAAA
ATATTCTCAAATTACTTTGAGTTACCAATAAATGAAAGATACGAGTTAGTTGCTTAAAAA
TTTGGTCATAGCAACACACAATTTTATTTGGATTTTTATCCTCTATACGATTTGTTTTTC
GCTTTTGCAGCCTAAAATTTAGGAAAAAAATATGAAGAGTCTATTGAAATTTATAATTTA
TTACAAATTGAGGAGCCTCATCATTTATATCAGGATACTCGTAAAATGAAAAGAAAAATT
ATTTATCATTATGGTCCAACAAATTCTGGAAAAACACACTCAGCTTTAGAAACTTTGATG
AGTGCTAAATCTGGAATATACTGTGGTCCACTCAGACTTTTGGCTAGAGAAATTTATTAA
AAATTTAAGTAAAGAGGGTTAAACTGTAATTTAATTACAGGTTAAGAAAAATTAATAGAG
CCTGATTCATAGTTCTACTCTTGTACCACTGAAATAGGATGCTAAAAAATTGATTTGGAT
TTTGATTGTGCTGTTATTGATGAAATATAGTATTTAGGTAATTATTTACAAATTTTACAA
TTAAATTTAATAATTATTTATTATAAAGGTGATTAAGAGAGAGGTGCTGCATGGACTAAA
GCTTTTTTAGGTCTTAAGGCTAAGGAAATACATGTCTGTGGCGATGGAAGAGCACTATAA
TTAGTAGAGAACATGTGTAAACAAGTTGGTGATTAATTTGAAACAGTCAAATATGAAAGA
ATGAGTTAATTAACTGTTGAAGATAAGCCATTTGAACTTCAAGATTTGCAAGAAGGAGTA
TATATTTATTTATAAAATTTATAATTTATGCCAATCTAAATTAATAAAATGAAGGACTGC
TTGATTTGCTTTAGCGTTAATGAGGCTATTTCTTTCAAAAGAATTGTTAACAATTATATT
AACTCTAAAAATCCTGATAATCCTTAGAGTTAAGAAAATTAATGTAGTATTATTTATGGT
AGATAGCCAGCTGAAATTAAAAAAGAATAAGCTGAACTATTTAATAATAGGACACATAAG
TATCTTGTTGCTACAAATGCAATAGGTCTTGGACTTAATTTAAATATAAGAAGAGTAGTT
TTCACAACATTTACTAAGAATCATTAAAGTTAAAGAAAAGGTATAGATTCGAATGAAATA
CTTTAGATTGCTGGAAGAGCTGGGAGATATAGGGAAGATGGATTAGTAACAGCAAGAAAT
GTAAAATAGATAAAAATACTAAAAGAAACTCTACAAAAAAGGGATTAACTCATATGTAAT
TTAAGCATTAATTTCCTTTTTTTCCAGAATATTTCAAAAAATTTGTTTAATTCTAATAAA
TTAAATGAATAAGTTGAGTAATAAATATATTTAAACCAATAAATATTTATTTCATTTATT
ATTCTAGAAATTTAAAAAAACTAAATTTTTAGTAAAAATTGTTTCAATTCTTGAAATTTG
TTTGATGTTTTGAAATTTAATATTTGATTTCTTTTTTTGTGATGATTAATAAAATTAAAT
TTAGAATAGTAAACCATTTAAAAAGCTGCTTTCTTCCCAACATATGAGCAGATTGAAGGT
TTTAGAGATTGGCTAAGCTAAGGAAAGAAAAAAAAATAGATAAAACTAAGTGAAGTCTTT
CAAAAGTTTGTAAATTATTCTACATTACAAGGAGCCTATTTTATAGAAAATGAAAGAGAA
TTTTGTCATAAGGCAGACCTAATTGAAGATTATGGATTGTCTCTTAGTGATTAATTTACA
TTTAGTTAAGCTCCTATGAGATTTGGAAAAGTTTTTGAAAAAGAGAGGGAACTATTCTAG
CTATTTGCTTAAAAATATGCTATGGGATAGGAAATTGCTTTACCAAATCTTTTAAAAGAT
GATGATAAAATCAAGAATATTAAATAGCAATAATAAGCCAATAAAGATTCGCTAACAATT
TATGAATCTCTGTATTACATTTTAGAATTATATATATGGCTTGGGAATAAATTTGGTGAA
GATAGATTCCCTGATATGCAATTAGCTCACAACAAAAAGTCAGTGATTTGTAGTATGATG
AATGAAATACATTCACATAACTAATATCAATGA


>TTHERM_00725930(protein)
MIKQRRFIFYQADIIAKQLIQRQSCMNISMLNLMAIQQSSSLLHQKSKTRQRSLFFQNVC
SFTDIAGTQPHQNKKKNVKSSQSESEEEEVNIRKKEDKKKDQTDAYHLIQKIQHSVPNIR
SRYYSMYDTFQNIYIEDNVQFFKEARFKFKINDIAIFCYFSLREIQDMYKKEHKILSFMM
EDKIIQRFRSHFDKNKRFQKIFSNYFELPINERYELVAQKFGHSNTQFYLDFYPLYDLFF
AFAAQNLGKKYEESIEIYNLLQIEEPHHLYQDTRKMKRKIIYHYGPTNSGKTHSALETLM
SAKSGIYCGPLRLLAREIYQKFKQRGLNCNLITGQEKLIEPDSQFYSCTTEIGCQKIDLD
FDCAVIDEIQYLGDQERGAAWTKAFLGLKAKEIHVCGDGRALQLVENMCKQVGDQFETVK
YERMSQLTVEDKPFELQDLQEGDCLICFSVNEAISFKRIVNNYINSKNPDNPQSQENQCS
IIYGRQPAEIKKEQAELFNNRTHKYLVATNAIGLGLNLNIRRVVFTTFTKNHQSQRKGID
SNEILQIAGRAGRYREDGLVTARNVKQIKILKETLQKRDQLIQQQTIQKAAFFPTYEQIE
GFRDWLSQGKKKKQIKLSEVFQKFVNYSTLQGAYFIENEREFCHKADLIEDYGLSLSDQF
TFSQAPMRFGKVFEKERELFQLFAQKYAMGQEIALPNLLKDDDKIKNIKQQQQANKDSLT
IYESLYYILELYIWLGNKFGEDRFPDMQLAHNKKSVICSMMNEIHSHNQYQ