Identifiers and Description

Gene Model Identifier

TTHERM_00726380

Standard Name

CYC30 (CYClin 30)

Aliases

PreTt21903 | 117.m00155

Description

amine-terminal domain cyclin

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04628.1 9.997093137033517e-262
Description: hypothetical protein (319 aa)
Oxytricha Contig11713.0.g24 0.000000000000004001928599951003
Description: Cyclin, N-terminal domain
DictyBase DDB_G0286617 0.000000019990673443141236
Description: cycK on chromosome: 4 position 4722525 to 4724281
WormBase WBGene00000507 0.000008000552149328928
Description: locus:cit-1.1 Cyclin-T1.1 status:Confirmed UniProt:P34425 protein_id:CCD63445.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00726380(coding)
ATGAAATTGTACAAGAAAAGTGAGATATTTTCTGAAAAATATAATAAGAATAGTGAATTA
GAAATAAGTCCAGAAGTTCAAAAGAAAATCATGGATGGAAATGCTGCATTTATAATTGAT
TTAATAGCAAGTTTAAAAATTCCTAGCTTCACTATATCATCACTTGGAATCCAGCTCGTT
AATTATTTTTTTATTGGAAAGAGCTACTTGAACTATGATAGATTCATTTACTGTGCTGCT
GCTTTGATGCTGGCATTTAAAATAAAGGAATAAGATCATTATAGGTTAAAGCCTATTATT
ATGGGATATTACCAGTAAGCACCAAGAAGGGACTAGACATAGATAATGAATGATACGATA
TATTAATAAATTAAAAATAAAATTTGCATAGCTGAAAGCAAATTGTTAAAAGCAATATAA
TTTGAATTCGATATATAGCTTCCCTTTGATTTCTTGCAAACAATTATTGAATTCTGTAAT
GAAAAAGATCAAGATAAAGAACGTATATATTATGCCACTAAGGTAATAAGTTATGATAGC
TTTAGAAGTTATGCTCCTCTTATTTTTAAACCACAAATTATAGCTGTTTCTGCTTTTATG
ATTAGCTGCTCTTAATTTAACATAGAACCACACTTAAGAATTCCTGAAAGATTCAAAGAA
AAGTATAATCCTGAGACTATGAGAGAAGAAGAAGCTTATGAAAGATGGCTGCAAGAAATT
TCTATAGAATTAAAAACATAAATTACTGCTGAAGATATAAAAGATTGCTTGTACGTACTA
AATGAACTTCTTTATCTTCACTATAATCCTAAAGAAGATGATTTAAAAAAATTTGAATAG
TATGAAACCTCTCTTGAATAAAGCAAAATTAAAAATGATCAAAATGAAAAACCAAATTAA
GAAAAATAGACTGAATAAAAAATGGATATTGAATAATAGTGA


>TTHERM_00726380(gene)
ATGAAATTGTACAAGAAAAGTGAGATATTTTCTGAAAAATATAATAAGAATAGTGAATTA
GAAATAAGTCCAGAAGTTCAAAAGAAAATCATGGATGGAAATGCTGCATTTATAATTGAT
TTAATAGCAAGTTTAAAAATGTAAATAATTGTTTTTTGAGAGATTTGGTTTTAATTTATA
CATAATTTATTAGCCAAGTTTATTCAAATAGTAATTTAAGACATTTCTTTAAAAATCCTA
TAGTCCTAGCTTCACTATATCATCACTTGGAATCCAGCTCGTTAATTATTTTTTTATTGG
AAAGAGCTACTTGAACTATGATAGATTCGTAATTACGCATTTACAAATGAATGAAATTAA
TTCAAATCAAAGAAAGTTTATTCGAAAAATACATCAAAAAATATGAATAAACAAATATAA
TTGAGAAGAATATAATTTTGAATTTATATTATTATCATAATGCATTATAAAATGGGAGTT
AGTTAGTTAATTGATTTTATTTTTAATTAGATTTACTGTGCTGCTGCTTTGATGCTGGCA
TTTAAAATAAAGGAATAAGATCATTATAGGTTAAAGCCTATTATTATGGGATATTACCAG
TAAGCACCAAGAAGGGACTAGACATAGATAATGAATGATACGATATATTAATAAATTAAA
AATAAAGTAAAAAATAATAATAATAAATAATTTTAATCTAATTAAATTATAAATAAAAAA
GATTTGCATAGCTGAAAGCAAATTGTTAAAAGCAATATAATTTGAATTCGATATATAGCT
TCCCTTTGATTTCTTGCAAACAATTATTGAATTCTGTAATGAAAAAGATCAAGATAAAGA
ACGTATATATTATGCCACTAAGGTAATAAGTTATGATAGCTTTAGAAGTTATGCTCCTCT
TATTTTTAAACCACAAATTATAGCTGTTTCTGCTTTTATGATTAGCTGCTCTTAATTTAA
CATAGAACCACAGTAATAATCTTTTTTTATTATTTCAGTTGAATAAAATAATATGTTCAA
TTATTAGCTTAAGAATTCCTGAAAGATTCAAAGAAAAGTATAATCCTGAGACTATGAGAG
AAGAAGAAGCTTATGAAAGATGGCTGCAAGAAATTTCTATAGAATTAAAAACATAAATTA
CTGCTGAAGATATAAAAGGTAATTTTATTTAGACTAATTTTAAAATCAAATTTATTTATT
TTATTGTTTAAATAATTATAAGATTGCTTGTACGTACTAAATGAACTTCTTTATCTTCAC
TATAATCCTAAAGAAGATGATTTAAAAAAATTTGAATAGTATGAAACCTCTCTTGAATAA
AGCAAAATTAAAAATGATCAAAATGAAAAACCAAATTAAGAAAAATAGACTGAATAAAAA
ATGGATATTGAATAATAGTGA


>TTHERM_00726380(protein)
MKLYKKSEIFSEKYNKNSELEISPEVQKKIMDGNAAFIIDLIASLKIPSFTISSLGIQLV
NYFFIGKSYLNYDRFIYCAAALMLAFKIKEQDHYRLKPIIMGYYQQAPRRDQTQIMNDTI
YQQIKNKICIAESKLLKAIQFEFDIQLPFDFLQTIIEFCNEKDQDKERIYYATKVISYDS
FRSYAPLIFKPQIIAVSAFMISCSQFNIEPHLRIPERFKEKYNPETMREEEAYERWLQEI
SIELKTQITAEDIKDCLYVLNELLYLHYNPKEDDLKKFEQYETSLEQSKIKNDQNEKPNQ
EKQTEQKMDIEQQ