Identifiers and Description

Gene Model Identifier

TTHERM_00727520

Standard Name

RAB59 (RAB GTPase 59)

Aliases

PreTt07253 | 118.m00081 | 3739.m00004

Description

RAB59 small guanosine triphosphatase family Ras-related in brain (Rab) family protein; Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17907.1 1.000434858898539e-105
Description: small GTP-binding protein domain-containing protein (185 aa)
DictyBase DDB_G0277867 3.998097515166115e-39
Description: rab1B on chromosome: 3 position 743092 to 744234
Oxytricha Contig15751.0.0.g87 8.003017249547689e-39
Description: Ras family
SGD YFL038C 2.00017271388466e-38
Description: YPT1 Rab family GTPase, involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by protein geranylgeranyltransferase type II (Bet2p-Bet4p)
WormBase WBGene00004284 1.999002769139511e-37
Description: locus:rab-35 status:Confirmed UniProt:Q9U2C3 protein_id:CAB57899.1
Stentor Coeruleus SteCoe_15778 1.5628821893349888e-18
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00727520(coding)
ATGTCTCAAATATCATAGCCATAATAAAATCAAAAAGAATAGTACGACTTCATGGTGAAA
GTAGTTTTAGTAGGTGATGAAGGAGTAGGTAAAACATAAATATCGAGGAGAATAGCAGGT
TTATAATATAACGAAAAGCATACTCCAACTATTGGAGTAGATTTCAAAGTTAAAACTATG
TAAGTAGGCAATAACATTATGAAATTTTAAGTATGGGATACTGCTGGCATACCTAAATAT
CGTGTATCAAATAAAGCTTAATACTCAGGAGCCGCTGCTGTTATAGTTATATTTAGCTTT
AATGATCTATAAAGCTTTGAGAGTGTTGAGAAATGGATATAAGAAATAAATTTTGAAAAT
TAGGATAGCTAAATAGTAAGAGTTTTAGTTGGAAATAAATGTGATTTTTAAAAGGAAGGA
AGATATGCCACTCCTATGGCTGCTGAATAATTAGCAAAGAGAAATAATATGGAATATATT
GAAGTATCTGCTAAAGAAAACCATAACGTTAGAGAGCTTTTCTAATTAGTAGGTTAACAA
ATATATAAAGAATTAATTGATCCTTAATGA


>TTHERM_00727520(gene)
ATGTCTCAAATATCATAGCCATAATAAAATCAAAAAGAATAGTACGACTTCATGGTGAAA
GTAGTTTTAGTAGGTGATGAAGGAGTAGGTAAAACATAAATATCGAGGAGAATAGCAGGT
TTATAATATAACGAAAAGCATACTCCAACTATTGGAGTAGATTTCAAAGTTAAAACTATG
TAAGTAGGCAATAACATTATGAAATTTTAAGTATGGGATACTGCTGGCATACCTAAATAT
CGTGTATCAAATAAAGCTTAATACTCAGGAGCCGCTGCTGTTATAGTTATATTTAGCTTT
AATGATCTATAAAGCTTTGAGAGTGTTGAGAAATGGATATAAGAAATAAATTTTGAAAAT
TAGGATAGCTAAATAGTAAGAGTTTTAGTTGGAAATAAATGTGATTTTTAAAAGGAAGGA
AGATATGCCACTCCTATGGCTGCTGAATAATTAGCAAAGAGAAATAATATGGAATATATT
GAAGTATCTGCTAAAGAAAACCATAACGTTAGAGAGCTTTTCTAATTAGTAGGTTAACAA
ATATATAAAGAATTAATTGATCCTTAATGA


>TTHERM_00727520(protein)
MSQISQPQQNQKEQYDFMVKVVLVGDEGVGKTQISRRIAGLQYNEKHTPTIGVDFKVKTM
QVGNNIMKFQVWDTAGIPKYRVSNKAQYSGAAAVIVIFSFNDLQSFESVEKWIQEINFEN
QDSQIVRVLVGNKCDFQKEGRYATPMAAEQLAKRNNMEYIEVSAKENHNVRELFQLVGQQ
IYKELIDPQ