Identifiers and Description

Gene Model Identifier

TTHERM_00728870

Standard Name

CPH1 (homolog of CAP-H, BRN1 condensin gene)

Aliases

PreTt07289 | 118.m00117 | 3739.m00039

Description

condensin complex subunit 2; condensin subunit- kleisin

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17942.1 4.999717172196908e-122
Description: hypothetical protein (294 aa)
Oxytricha Contig18145.0.g34 4.999245259173412e-21
Description: Condensin complex subunit 2
DictyBase DDB_G0292066 6.998542127613979e-20
Description: ncapH on chromosome: 6 position 1141212 to 1144129
SGD YBL097W 0.0000000006999585478469937
Description: BRN1 Subunit of the condensin complex; required for chromosome condensation and for clustering of tRNA genes at the nucleolus; may influence multiple aspects of chromosome transmission

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29237819: Howard-Till R, Loidl J (2018) Condensins promote chromosome individualization and segregation during mitosis, meiosis, and amitosis in Tetrahymena thermophila. Molecular biology of the cell 29(4):466-478

Sequences

>TTHERM_00728870(coding)
ATGAATAAAAGTCACAAAGGTGGTAGATTACTTAAGAAAAAAATATTATAAGAAGTATAG
GAAAAAGATGATTATTATGACGACGAAGATTTATTAACTAATGAAGAATTAAAAATGATG
TAAGCAAATGCAAAAAATGCTAAGAATAAGATCTAAATTAGAGTTAAATCAGATAGTTTA
TTAAATGAATATTCGTACAAATAAAAAATGTTAGGAAAAACGAATAACTCCTTCTACTAA
AATAGAAATGGCATTAATACAAAAAAAATGAACAATTAAACTACTTATAAATCTGATAAA
TTAATTTTGGATGAAGAAGAAGATGAAGAAGAAGAAAATGTATTAAGAGAATTAAACGTT
ATTGATGTTAAAGATATTTTAGAAGATGCACGTAGAAAATCAGAAGGTAATAATAACTAG
TAAAAAAAGAACTAAGATGCTCTATGCTTAATATTAGCTCAAATGCTTCTTAAAAATAAA
ATAAACAAAGAAAATGCCTTCGAAATACCTCTTCCAGATGTTAAGAATATGTCTGATTTT
GCAAAGGTAAGCGAAGCTTCTTGGTAGAAATTATCTAGCTCTATCGATTCTGGTTCGAAG
ATATATGGATATAGAGTAGATAGCTTGCACTAAGAATCATTTAAGATGCTTAGTGGTTTG
ATTAGATCTGAGTTTATTAACAAAGATGAAGATCATCATGGCAAATAAGAGCAAGACAGT
GAAGACCTTATTAATAAAGAAAGGGAAAAGATATTTAAGAAAAATAAAAAGATAAATGAA
TCTACCATTGAAAAAAATTTATCTAACATTACATTGAATAAGTATGATATATAGTTTGAA
GTAGATCCTTTATTCTGCAAAACTAGTGAAAAATTTGATGATAGCAGCTCTAAAGGAATT
CTTTTAAATAATATAAAGATAGACTCTAATTTAAAATTATTAATTGATTCAGAAAATTTT
GTACACAATCTACCTTAGGATTCAAGTGCAAGATAATCTTTAGATAAAGATTAGCAAAAT
ACTCCTATGAAGAAAAAATCCGACAAAAAAAAAGTTAAAGGACTATATAAAAATGAGAAA
TTATCTCTCTAGAATATTTAGATAAGAAGTGATTTATACGAGCTAGAGCTCTGTAGTGGT
TTAGAAAATTTTGTAGGCAATATGCTAAACTTGGAAGATTCTAACAAGAAATTTAATAGA
ACTGTAATAGAAGAAAACGATGAAGAATATCAGTAAGATAATGATGATTTGAACTCCCAT
AAAAAATTAGTTGATGAACTAGTTATGAATTAAAATGAACAAGAATTAATTAATGATATT
CAAATGATTTTAACTCAAACAGCTAAGAAAGGAAAAACTGCCATGAAAATGAGTTAAAAG
AGCATATTAAACGAATCTCAAGACAGTGCATTTCATTAAGAAAACCAAATTATCTCAACA
AATATGAGTCCTTTTTAAGATATATAATTTAACTCTTAAAATCAAAAAAGCGAATATTTA
AGTGAAAAATTAAGATAAAGTTAATTTCTTAATAGTACCAATAATTAAATGGAAGTTATT
AATGAAGGGATACTCTGTAATGATAACCCATAAGATTATTATTAGTAATGTGATGATGAT
GTCCCTAATTATAGCTCAAATTAATATAAATTATTGACAGATGATTTACCCAGCAAAGAA
TCATCAAATGGATTTACTAATTCATTTACTAACACAATAGGTGATTTTGAGTAACCAGAG
GACAGATTATTTTCTTTATAAAATATGGCTATTAGAATGACTTAAATTGGAAGTGGATTA
TTCTTTAATCAAATTGAAAAAGATAAAACTTAATGGATGAATCCTATTGACTGGAAAATT
TTAAATTAAAAGAAAAATAATATCATGGTTGCTGAAATTCCATAAACAGAAAGGAATAGA
ACAAAAAGAAAAAATAATTAAAAAGATTCTGAATTTAGATTTGATTTCTTTGATGAGCAA
GAGTACAAAATCGAAGAAGTAAAAGGAAAAAATAAAAAATAAAGATCTGCATTTAAGATT
TTTGATACAGAAATCACACATTTACAATTATTGAGCATAGACTACCATTACAAACCATAA
TGGCTTTTCAAGACAAGTTATTTTGACTTGAAAGAAATTGAAGAATAAGAAAGACTTGCT
TAATAAAGATTGTAAGAAGAGGAAGAGTAATACAAAGGATTCAATGGTGACGATGAGTAT
GATATAATAAACTAAATTGATGAATATACATTATTAGGAGCAACTCCGTTTAGAAATACC
TAAATGGAGGTTATGAATGACAATTACGATTGCACTAATACTTAAGCTAATAATAATTTA
TCTCAATAAAATGTAAATACATAGATTACAAGTTAATATGAGCACACTCAAAGTTATCCA
GAAAGCAAAAATCAATAAAGAAAAAAATAAAATGTTAGAAAAATGAAAATATAAGAACTT
AAATAGAGAATTTGGATAAATTTATAGGACAAGATTTAAGACCAAGTTGAGATATCTTAT
ACTGACTTGATTAATCAGCTTTAACTTCAAAAGTAAGAATAGGCCTCTATCTAAAGTTGT
CTTGTTGCTATACTACACTTGTGCAATGAAAATAATCTGCAATTATATAATAATACCTAA
GATAATTTTCTCATCAAAAGAAATACTATCTAAGAATAACAATTGCAAGAAATGTCTTAA
GATTGA


>TTHERM_00728870(gene)
ATGAATAAAAGTCACAAAGGTGGTAGATTACTTAAGAAAAAAATATTATAAGAAGTATAG
GAAAAAGATGATTATTATGACGACGAAGATTTATTAACTAATGAAGAATTAAAAATGATG
TAAGCAAATGCAAAAAATGCTAAGAATAAGATCTAAATTAGAGTTAAATCAGATAGTTTA
TTAAATGAATATTCGTACAAATAAAAAATGTTAGGAAAAACGAATAACTCCTTCTACTAA
AATAGAAATGGCATTAATACAAAAAAAATGAACAATTAAACTACTTATAAATCTGATAAA
TTAATTTTGGATGAAGAAGAAGATGAAGAAGAAGAAAATGTATTAAGAGAATTAAACGTT
ATTGATGTTAAAGATATTTTAGAAGATGCACGTAGAAAATCAGAAGGTAATAATAACTAG
TAAAAAAAGAACTAAGATGCTCTATGCTTAATATTAGCTCAAATGCTTCTTAAAAATGTA
TTTTTTTATTTATCAATTCATTCAGCCTTTATTTTTTATATATGGTAATTTAAAAAAAAA
AATTAATAGAAAATAAACAAAGAAAATGCCTTCGAAATACCTCTTCCAGATGTTAAGAAT
ATGTCTGATTTTGCAAGTATTTTTTGAAATTATTTTATTTGATTATGTTAAATTAACTCC
TTTAAAAATACTTATAATGAATTTAAAAGAGGTAAGCGAAGCTTCTTGGTAGAAATTATC
TAGCTCTATCGATTCTGGTTCGAAGATATATGGATATAGAGTAGATAGCTTGCACTAAGA
ATCATTTAAGATGCTTAGTGGTTTGATTAGATCTGAGTTTATTAACAAAGATGAAGATCA
TCATGGCAAATAAGAGCAAGACAGTGAAGACCTTATTAATAAAGAAAGGGAAAAGATATT
TAAGAAAAATAAAAAGATAAATGAATCTACCATTGAAAAAAATTTATCTAACATTACATT
GAATAAGTATGATATATAGTTTGAAGTAGATCCTTTATTCTGCAAAACTAGTGAAAAATT
TGATGATAGCAGCTCTAAAGGAATTCTTTTAAATAATATAAAGGTAATTTTATTCAGAAT
TCTTTAATACAAATTTTTAAAAATTATTTAGATAGACTCTAATTTAAAATTATTAATTGA
TTCAGAAAATTTTGTACACAATCTACCTTAGGATTCAAGTGCAAGATAATCTTTAGATAA
AGATTAGCAAAATACTCCTATGAAGAAAGTAATTAAATCTCTCTTTTAACTTGAAGTGAA
ATATTTATTTTTTTTTATTAATTTTATAGAAATCCGACAAAAAAAAAGTTAAAGGACTAT
ATAAAAATGAGAAATTATCTCTCTAGAGTAAGTTAAACCAGAACGAATACAATTTAATTG
CTTATTTTTACAAGATATTTAGATAAGAAGTGATTTATACGAGCTAGAGCTCTGTAGTGG
TTTAGAAAATTTTGTAGGCAATATGCTAAACTTGGAAGATTCTAACAAGAAATTTAATAG
AACTGTAATAGAAGAAAACGATGAAGAATATCAGTAAGATAATGATGATTTGAACTCCCA
TAAAAAATTAGTTGATGAACTAGTTATGAATTAAAATGAACAAGAATTAATTAATGATAT
TCAAATGATTTTAACTCAAACAGCTAAGAAAGGAAAAACTGCCATGAAAATGAGTTAAAA
GAGCATATTAAACGAATCTCAAGACAGTGCATTTCATTAAGAAAACCAAATTATCTCAAC
AAATATGAGTCCTTTTTAAGATATATAATTTAACTCTTAAAATCAAAAAAGCGAATATTT
AAGTGAAAAATTAAGATAAAGTTAATTTCTTAATAGTACCAATAATTAAATGGAAGTTAT
TAATGAAGGGATACTCTGTAATGATAACCCATAAGATTATTATTAGTAATGTGATGATGA
TGTCCCTAATTATAGCTCAAATTAATATAAATTATTGACAGATGATTTACCCAGCAAAGA
ATCATCAAATGGATTTACTAATTCATTTACTAACACAATAGGTGATTTTGAGTAACCAGA
GGACAGATTATTTTCTTTATAAAATATGGCTATTAGAATGACTTAAATTGGAAGTGGATT
ATTCTTTAATCAAATTGAGTAAATTAAATTAATTTCTTTATTTTGTTTGATAAAATTAAT
TAATTTTGATATTTATTATAGAAAAGATAAAACTTAATGGATGAATCCTATTGACTGGAA
AATTTGTAAAATAGCTTATTTGTGTTTTTTTATGAATTATTTTATAAATAATTTTAAGTA
AATTAAAAGAAAAATAATATCATGGTTGCTGAAATTCCATAAACAGAAAGGAATAGAACA
AAAAGAAAAAATAATTAAAAAGATTCTGAATTTAGATTTGATTTCTTTGATGAGCAAGAG
TACAAAATCGAAGAAGTAAAAGGAAAAAATAAAAAATAAAGATCTGCATTTAAGATTTTT
GATACAGAAATCACACATTTACAATTATTGAGCATAGACTACCATTACAAACCATAATGG
TAAAGAAAACGATTTAAATGAATATTTATATTTTTTTGTATAAAGGCTTTTCAAGACAAG
TTATTTTGACTTGAAAGAAATTGAAGAATAAGAAAGACTTGCTTAATAAAGATTGTAAGA
AGAGGAAGAGTAATACAAAGGATTCAATGGTGACGATGAGTATGATATAATAAACTAAAT
TGATGAATATACATTATTAGGAGCAACTCCGTTTAGAAATACCTAAATGGAGGTTATGAA
TGACAATTACGATTGCACTAATACTTAAGCTAATAATAATTTATCTCAATAAAATGTAAA
TACATAGATTACAAGTTAATATGAGCACACTCAAAGTTATCCAGAAAGCAAAAATCAATA
AAGAAAAAGTAAGAAATTTTTTAAGATAAAAGCTTTTTTATATTTCCTTAAAAAAAATAA
ATAGAATAAAATGTTAGAAAAATGAAAATATAAGAACTTAAATAGAGAATTTGGATAAAT
TTATAGGACAAGATTTAAGACCAAGTTGAGGTAATCCAAACTTTTAATTTAAAATTTAGT
TTCTTATTTTAATAAATTAAAGATATCTTATACTGACTTGATTAATCAGCTTTAACTTCA
AAAGTAAGAATAGGCCTCTATCTAAAGTTGTCTTGTTGCTATACTACACTTGTGCAATGA
AAATAATCTGCAATTATATAATAATACCTAAGATAATTTTCTCATCAAAAGAAATACTAT
CTAAGAATAACAATTGCAAGAAATGTCTTAAGATTGA


>TTHERM_00728870(protein)
MNKSHKGGRLLKKKILQEVQEKDDYYDDEDLLTNEELKMMQANAKNAKNKIQIRVKSDSL
LNEYSYKQKMLGKTNNSFYQNRNGINTKKMNNQTTYKSDKLILDEEEDEEEENVLRELNV
IDVKDILEDARRKSEGNNNQQKKNQDALCLILAQMLLKNKINKENAFEIPLPDVKNMSDF
AKVSEASWQKLSSSIDSGSKIYGYRVDSLHQESFKMLSGLIRSEFINKDEDHHGKQEQDS
EDLINKEREKIFKKNKKINESTIEKNLSNITLNKYDIQFEVDPLFCKTSEKFDDSSSKGI
LLNNIKIDSNLKLLIDSENFVHNLPQDSSARQSLDKDQQNTPMKKKSDKKKVKGLYKNEK
LSLQNIQIRSDLYELELCSGLENFVGNMLNLEDSNKKFNRTVIEENDEEYQQDNDDLNSH
KKLVDELVMNQNEQELINDIQMILTQTAKKGKTAMKMSQKSILNESQDSAFHQENQIIST
NMSPFQDIQFNSQNQKSEYLSEKLRQSQFLNSTNNQMEVINEGILCNDNPQDYYQQCDDD
VPNYSSNQYKLLTDDLPSKESSNGFTNSFTNTIGDFEQPEDRLFSLQNMAIRMTQIGSGL
FFNQIEKDKTQWMNPIDWKILNQKKNNIMVAEIPQTERNRTKRKNNQKDSEFRFDFFDEQ
EYKIEEVKGKNKKQRSAFKIFDTEITHLQLLSIDYHYKPQWLFKTSYFDLKEIEEQERLA
QQRLQEEEEQYKGFNGDDEYDIINQIDEYTLLGATPFRNTQMEVMNDNYDCTNTQANNNL
SQQNVNTQITSQYEHTQSYPESKNQQRKKQNVRKMKIQELKQRIWINLQDKIQDQVEISY
TDLINQLQLQKQEQASIQSCLVAILHLCNENNLQLYNNTQDNFLIKRNTIQEQQLQEMSQ
D