Identifiers and Description

Gene Model Identifier

TTHERM_00729130

Standard Name

MRNC25 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt07314 | 118.m00142 | 3739.m00064

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17972.1 9.997093137033517e-262
Description: hypothetical protein (513 aa)
Oxytricha Contig13677.0.1.g35 1.9994498063102785e-22
Description: MORN repeat
Stentor Coeruleus SteCoe_23375 0.00000000003775134544279098
Description: None
WormBase WBGene00002179 0.000030009396760408108
Description: locus:jph-1 status:Confirmed UniProt:Q22667 protein_id:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00729130(coding)
ATGTTTGAATCTGTTGAAGAGTAGTTGCTCGAAAGAGAAATGATGAAAATTATCAAGTAG
TTTTAACTAAATATTGATATCGAAAAAAATCAAGAAGTGAAAGTATAAAATGGCCAAAAG
GATAAGGAAATAAACATAAAATCACAGAATAAAGAAGTAGAAAAAGTAAATAAGGCAGTT
GGAGATGAAGAAATAGATTGGGAATAAAACTATTTAGATTTAATGTAAGAATGTGGTTAT
TAATTACCAGATGAAGAAATTAATACCCAACTTGACAACGAAAATGAAAAAAAAATTAAT
TTGATGATATAAAAAAATGATGAATGCCATAATAGGGATTTTGCATAATATAAATTGTAG
CCTATAAATAATGAGAGTGATGATTAAGAAAGCGAAGAAGTCTAAAAATCAAAATAGATG
ATGAATGACCTTCATGATGAAGAAGAATAAATTATGACTCCAGAACAATAAAAGGAGTAT
TTTAAATCATTACGCAGTAAATACTTAAATGTAAAATAAGTAGATGAGTAAAAGTAAACA
GAAAAATCAGTTGATACAACTGCTTATGCAACAAATGAATCTGATACCACTTAAATAAGT
AGCTAAAATGTAGCTAATAATTAAAAATAATAGCCTTTATTAGAGGAAAAATAACTTGAA
TAGACTTAAAATGATGATTAAGGATAATTAAAATAAAATGATAGCAGTTAAATTTAAAAA
TAAAATGAAAATAGTCAAAGCATAGATAAGCCTAGAAGTTTATTGCCATAAGATCACGTT
ACTTTAACAAGAGAAATGTATGATGAATAGAAAAAGCAATAAAAAGCTCTAAAAAAGGCA
ATTCAAAATGCTAAAGATTTAGGTATAGTTTACAATGGAGTAATTAACTTTGAAAATTTC
GATGAGACTAGCAGTGAAGAAGGAGAAGATTAAAATAAGCTTTAAGATTAAGAATAAGAT
GAATAATTAGAAGACAATAATGTCATAGAAGAGTAGGATGAAGATGAATATGATGAAAAC
AATGACTAAACAACTTAAGATGAACAAGTAAATGTCTTGACTGAAATAAAAAGAGAATAT
ATTTAGACTAATAAATGGAATTGTAAAGAATATAAGATATTTTACTCAAACGAGGACATA
TACGAAGGTGAGATAGATGATAAAACATCTCTTAAAGATGGTTGGGGTGTTTACTTATAT
GCGAACGGTGAAAAATATGAAGGGTTCTTCTAAGATGATATTATCCATGGATATGGAAGA
TATTAATTTTTAGGAGGACATAAGTATGAAGGCGATTGGAGTTAAGGTATGAAACATGGT
GTGGGAATTCTTGAATTTGCTTCAGGAGATAAGTATATAGGATTTTTTGAGCGTGATAAT
TTCCATGGATAAGGTGAATACTTTTACAAGAATGGAGATAAGTTTGAAGGTACATTCGTA
CATGGAAAAAAAAATGGCACCGGTAAATTTTTAGGAGCTAATGGAAGAAAAATAATAGGA
GAATGGATTGATGATCAACTTTAACATTTTTGA


>TTHERM_00729130(gene)
ATGTTTGAATCTGTTGAAGAGTAGTTGCTCGAAAGAGAAATGATGAAAATTATCAAGTAG
TTTTAACTAAATATTGATATCGAAAAAAATCAAGAAGTAATAGATTACAACAGTTATTTT
TATTTAGTTAACTTTAATGCTTATAAATTATTTCAATCATTTTATTTACAGGTGAAAGTA
TAAAATGGCCAAAAGGATAAGGAAATAAACATAAAATCACAGAATAAAGTAAATAAACAT
TTGAGATATACTTTTACTTAAGCTCAAATATTAAAAAAGGAAGTAGAAAAAGTAAATAAG
GCAGTTGGAGATGAAGAAATAGATTGGGAATAAAACTATTTAGATTTAATGTAAGAATGT
GGTTATTAATTACCAGATGAAGAAATTAATACCCAACTTGACAACGAAAATGAAAAAAAA
ATTAATTTGATGATATAAAAAAATGATGAATGCCATAATAGGGATTTTGCATAATATAAA
TTGTAGCCTATAAATAATGAGAGTGATGATTAAGAAAGCGAAGAAGTCTAAAAATCAAAA
TAGATGATGAATGACCTTCATGATGAAGAAGAATAAATTATGACTCCAGAACAATAAAAG
GAGTATTTTAAATCATTACGCAGTAAATACTTAAATGTAAAATAAGTAGATGAGTAAAAG
TAAACAGAAAAATCAGTTGATACAACTGCTTATGCAACAAATGAATCTGATACCACTTAA
ATAAGTAGCTAAAATGTAGCTAATAATTAAAAATAATAGCCTTTATTAGAGGAAAAATAA
CTTGAATAGACTTAAAATGATGATTAAGGATAATTAAAATAAAATGATAGCAGTTAAATT
TAAAAATAAAATGAAAATAGTCAAAGCATAGATAAGCCTAGAAGTTTATTGCCATAAGAT
CACGTTACTTTAACAAGAGAAATGTATGATGAATAGAAAAAGCAATAAAAAGCTCTAAAA
AAGGCAATTCAAAATGCTAAAGATTTAGGTATAGTTTACAATGGAGTAATTAACTTTGAA
AATTTCGATGAGACTAGCAGTGAAGAAGGAGAAGATTAAAATAAGCTTTAAGATTAAGAA
TAAGATGAATAATTAGAAGACAATAATGTCATAGAAGAGTAGGATGAAGATGAATATGAT
GTATTGATTATTAAATTTTATATTTCTATTTGAAATAAAAATAAATTAAAAAAATAAATA
AATGAAGGAAAACAATGACTAAACAACTTAAGATGAACAAGTAAATGTCTTGACTGAAAT
AAAAAGAGAATATATTTAGACTAATAAATGGAATTGTAAAGAATATAAGATATTTTACTC
AAACGAGGACATATACGAAGGTGAGATAGATGATAAAACATCTCTTAAAGATGGTTGGGG
TGTTTACTTATATGCGAACGGTGAAAAATATGAAGGGTTCTTCTAAGATGATATTATCCA
TGGATATGGAAGATATTAGTAAATTTAACAAATTATAATCGAATTTTATCACTTTTTTAT
TTATCAGATTTTTAGGAGGACATAAGTATGAAGGCGATTGGAGTTAAGGTATGAAACATG
GTGTGGGAATTCTTGAATTTGCTTCAGGAGATAAGTATATAGGATTTTTTGAGCGTGATA
ATTTCCATGGATAAGGTAGAATTGAATTTTCAAAAAGCTTATATAATTTAAATAAATTAA
TAAAAGGTGAATACTTTTACAAGAATGGAGATAAGTTTGAAGGTACATTCGTACATGGAA
AAAAAAATGGCACCGGTAAATTTTTAGGAGCTAATGGAAGAAAAATAATAGGAGAATGGA
TTGATGATCAACTTTAACATTTTTGA


>TTHERM_00729130(protein)
MFESVEEQLLEREMMKIIKQFQLNIDIEKNQEVKVQNGQKDKEINIKSQNKEVEKVNKAV
GDEEIDWEQNYLDLMQECGYQLPDEEINTQLDNENEKKINLMIQKNDECHNRDFAQYKLQ
PINNESDDQESEEVQKSKQMMNDLHDEEEQIMTPEQQKEYFKSLRSKYLNVKQVDEQKQT
EKSVDTTAYATNESDTTQISSQNVANNQKQQPLLEEKQLEQTQNDDQGQLKQNDSSQIQK
QNENSQSIDKPRSLLPQDHVTLTREMYDEQKKQQKALKKAIQNAKDLGIVYNGVINFENF
DETSSEEGEDQNKLQDQEQDEQLEDNNVIEEQDEDEYDENNDQTTQDEQVNVLTEIKREY
IQTNKWNCKEYKIFYSNEDIYEGEIDDKTSLKDGWGVYLYANGEKYEGFFQDDIIHGYGR
YQFLGGHKYEGDWSQGMKHGVGILEFASGDKYIGFFERDNFHGQGEYFYKNGDKFEGTFV
HGKKNGTGKFLGANGRKIIGEWIDDQLQHF