Identifiers and Description

Gene Model Identifier

TTHERM_00735230

Standard Name

CTH84 (CaTHepsin 84)

Aliases

PreTt25447 | 120.m00105

Description

CTH84 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF00806 ) Pumilio-family RNA binding repeat
  • ( PF02520 ) Domain of unknown function DUF148
  • ( PF03544 ) Gram-negative bacterial tonB protein
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18921.1 9.999130229490956e-141
Description: papain family cysteine protease containing protein (328 aa)
DictyBase DDB_G0290957 4.998233068678632e-48
Description: cprA on chromosome: 5 position 4812963 to 4814596
Oxytricha Contig322.1.g116 2.99915080840225e-45
Description: Papain family cysteine protease
WormBase WBGene00000776 3.00039543526891e-44
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
Stentor Coeruleus SteCoe_27084 3.532628572200807e-24
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00735230(coding)
ATGAATAAATCAATATTGATTTTTGCATTTTTAGCAGCTGCACTTTTTGGGTCAGCATTG
TATATGGCGGTTAAAAAATAACATATTACAATAGATGAATCAGTAACTAAGATTTGGAGT
TAATGGAAATAAAAACACAATAAGAGATATGAAAATACTGATTATGAATCTTACAGGTTG
GAAGTTTTTGCTGAAAATTTAGAAGTAGTTAAAAATGATTAAACTGGAACTTATGGTATA
ACCAAATTTTTAGATCTAACAGACGATGAATTCGCAGGAAATTTTCTCAATTTAAAAGCA
CAATATCCTGAAGATTCTATAGCAGAAGACATTGAAGTAGACCCAAAAATTAACATTAAT
TGGGTTGAAGCAGGAAAAGTTTCTAATGTTAAATCTTAAGGAAACTGCGGTTCCTGCTGG
GCATTTTCAGCAACTGCTTCTGTTGAATCAGCTTTGATTATTGCTGGTAAAGTTGATAAA
TCTATTAGCCTTTCAGAATAGTAATTAATAGATTGTTCTGGAGATTATGGAAATTATGGA
TGCGCTGCTGGATAAAAAGAATAAGCTTTGGTTTATATTAAAAGATATTCAATTACTACT
GAATAAAATTATCCTTATACAGAAAAAGATGTTTAAAAATGTTACTTTGATAACACAAAA
CATATTCCTAATTACACTATTTCTGATATCAAAATTGTTAAAGCATCAACTAATGACTTG
GTAGAAGCTCTCAAGATCTAGCCTGTCGCCGTTTCAGTAGATGCAACTAATTGGAAATAC
TACAAAGGCGGTGTATTTTCTGACTGTAAAACTTATTATCATAACCATGCAGTACTTTTA
GTTGGATTCTAAAATGGAACTTGGCTAGTTAAAAACTCATATGGAACTAATTGGGGAGAA
AATGGCTATATTAGACTTAAAAATGGCAATACATGTGGAGTAGCAAATTAACCTTATCAG
CCTATAATTTGA


>TTHERM_00735230(gene)
ATGAATAAATCAATATTGATTTTTGCATTTTTAGCAGCTGCACTTTTTGGGTCAGCATTG
TATATGGCGGTTAAAAAATAACATATTACAATAGATGAATCAGTAACTAAGATTTGGAGT
TAATGGAAATAAAAACACAATAAGAGATATGAAAATACTGATTATGAATCTTACAGGTTG
GAAGTTTTTGCTGAAAATTTAGAAGTAGTTAAAAATGATTAAACTGGAACTTATGGTATA
ACCAAATTTTTAGATCTAACAGACGATGAATTCGCAGGAAATTTTCTCAATTTAAAAGCA
CAATATCCTGAAGATTCTATAGCAGAAGACATTGAAGTAGACCCAAAAATTAACATTAAT
TGGGTTGAAGCAGGAAAAGTTTCTAATGTTAAATCTTAAGGAAACTGCGGTTCCTGCTGG
GCATTTTCAGCAACTGCTTCTGTTGAATCAGCTTTGATTATTGCTGGTAAAGTTGATAAA
TCTATTAGCCTTTCAGAATAGTAATTAATAGATTGTTCTGGAGATTATGGAAATTATGGA
TGCGCTGCTGGATAAAAAGAATAAGCTTTGGTTTATATTAAAAGATATTCAATTACTACT
GAATAAAATTATCCTTATACAGAAAAAGATGTTTAAAAATGTTACTTTGATAACACAAAA
CATATTCCTAATTACACTATTTCTGATATCAAAATTGTTAAAGCATCAACTAATGACTTG
GTAGAAGCTCTCAAGATCTAGCCTGTCGCCGTTTCAGTAGATGCAACTAATTGGAAATAC
TACAAAGGCGGTGTATTTTCTGACTGTAAAACTTATTATCATAACCATGCAGTACTTTTA
GTTGGATTCTAAAATGGAACTTGGCTAGTTAAAAACTCATATGGAACTAATTGGGGAGAA
AATGGCTATATTAGACTTAAAAATGGCAATACATGTGGAGTAGCAAATTAACCTTATCAG
CCTATAATTTGA


>TTHERM_00735230(protein)
MNKSILIFAFLAAALFGSALYMAVKKQHITIDESVTKIWSQWKQKHNKRYENTDYESYRL
EVFAENLEVVKNDQTGTYGITKFLDLTDDEFAGNFLNLKAQYPEDSIAEDIEVDPKININ
WVEAGKVSNVKSQGNCGSCWAFSATASVESALIIAGKVDKSISLSEQQLIDCSGDYGNYG
CAAGQKEQALVYIKRYSITTEQNYPYTEKDVQKCYFDNTKHIPNYTISDIKIVKASTNDL
VEALKIQPVAVSVDATNWKYYKGGVFSDCKTYYHNHAVLLVGFQNGTWLVKNSYGTNWGE
NGYIRLKNGNTCGVANQPYQPII