Identifiers and Description

Gene Model Identifier

TTHERM_00735240

Standard Name

ARF1 (ADP-Ribosylation Factor 1 )

Aliases

PreTt25448 | 120.m00106

Description

ARF1 ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPase family protein; ADP-ribosylation factor; regulates vesicle trafficking

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10625.1 6.002263356957296e-125
Description: small GTP-binding protein domain-containing protein (221 aa)
WormBase WBGene00000183 3.9981372112117256e-92
Description: locus:arf-3 status:Confirmed UniProt:G5EFK4 protein_id:CCD69768.1
Oxytricha Contig578.1.g56 5.999393432078778e-90
Description: ADP-ribosylation factor family
DictyBase DDB_G0289173 5.0002513615276457e-88
Description: arfA on chromosome: 5 position 2516577 to 2517682
SGD YDL192W 9.000840820639671e-86
Description: ARF1 ADP-ribosylation factor, GTPase of the Ras superfamily involved in regulation of coated vesicle formation in intracellular trafficking within the Golgi; functionally interchangeable with Arf2p
Stentor Coeruleus SteCoe_35451 8.194012623990515e-40
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00735240(coding)
ATGGGTATACAACTTTCTAAGCTTTTCGACAAGATTTTCAATAAGGTCGAAATGAGAATT
TTGATGTTAGGTCTCGATGCCGCTGGTAAGACCACCATTCTTTATAGATTGAAGCTCGGT
GAAGTCGTTTAGAGTGTTCCTACCATTGGTTTCAACGTTGAAAGTGTTGAATACAAGAAG
ATTAAATTTACAGTTTGGGACGTCGGCGGTTAAGACAAGATTAGACTCTTATGGAGACAT
TACTTCCAAGGTACCCAAGGTCTCATTTTCGTCGTCGATTCCTCTGATAAGGAACGTATC
GAAATTGCCAAGGAAGAATTACAAAGAATGCTTTCCGAAGATGACCTCAAGGAAGCTGCA
GTCCTTGTCTTCGCCAACAAGCAAGATATGGGTGTCATGAATGTCACTGAAATCACTGAA
AAGTTAGGTCTCGCCAACCTCAGAGGACGTGAATGGTTCATCCAAGGAACCTGCGCTCTC
AGTGGTGAAGGTTTATTCGAAGGTCTTGACTGGCTCTCCAAGGTCGTCAGCAAAAAGAAA
TGA


>TTHERM_00735240(gene)
ATGGGTATACAACTTTCTAAGCTTTTCGACAAGATTTTCAATAAGGTCGAAATGAGAATT
TTGATGTTAGGTCTCGATGCCGCTGGTAAGACCACCATTCTTTATAGATTGAAGCTCGGT
GAAGTCGTTTAGAGTGTTCCTACCATTGGTTTCAACGTTGAAAGTGTTGAATACAAGAAG
ATTAAATTTACAGTTTGGGACGTCGGCGGTTAAGACAAGATTAGACTCTTATGGAGACAT
TACTTCCAAGGTACCCAAGGTCTCATTTTCGTCGTCGATTCCTCTGATAAGGAACGTATC
GAAATTGCCAAGGAAGAATTACAAAGAATGCTTTCCGAAGATGACCTCAAGGAAGCTGCA
GTCCTTGTCTTCGCCAACAAGCAAGATATGGGTGTCATGAATGTCACTGAAATCACTGAA
AAGTTAGGTCTCGCCAACCTCAGAGGACGTGAATGGTTCATCCAAGGAACCTGCGCTCTC
AGTGGTGAAGGTTTATTCGAAGGTCTTGACTGGCTCTCCAAGGTCGTCAGCAAAAAGAAA
TGA


>TTHERM_00735240(protein)
MGIQLSKLFDKIFNKVEMRILMLGLDAAGKTTILYRLKLGEVVQSVPTIGFNVESVEYKK
IKFTVWDVGGQDKIRLLWRHYFQGTQGLIFVVDSSDKERIEIAKEELQRMLSEDDLKEAA
VLVFANKQDMGVMNVTEITEKLGLANLRGREWFIQGTCALSGEGLFEGLDWLSKVVSKKK