Identifiers and Description

Gene Model Identifier

TTHERM_00756450

Standard Name

RRM48 (RNA recognition motif-containing protein 48)

Aliases

PreTt18308 | 123.m00127 | 3742.m00057

Description

RRM48 RNA-binding protein 42 (RBM42)-like RNA recognition motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( PF05172 ) MPPN (rrm-like) domain
  • ( PF07491 ) Protein phosphatase inhibitor
  • ( TIGR00166 ) ribosomal protein S6
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_15406.1 9.997093137033517e-262
Description: RNA binding protein (445 aa)
Oxytricha Contig7157.0.g23 9.999888128184441e-42
Description: RNA recognition motif_ (a_k_a_ RRM, RBD, or RNP domain)
DictyBase DDB_G0289941 2.9998215087698487e-30
Description: DDB_G0289941 on chromosome: 5 position 3478416 to 3479861
SGD YOL041C 7.003307964816097e-28
Description: NOP12 Nucleolar protein involved in pre-25S rRNA processing and biogenesis of large 60S ribosomal subunit; contains an RNA recognition motif (RRM); binds to Ebp2; similar to Nop13p and Nsr1p
WormBase WBGene00008688 1.999790113608142e-24
Description: status:Confirmed UniProt:Q95QL3 protein_id:CAC70081.1
Stentor Coeruleus SteCoe_26182 2.6102790696677047e-23
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00756450(coding)
ATGAGCGGAACTTTAGGATATTTATTATAGCAAAGTGCTTAAAATCAAGGAAAAAAATCC
AATGAAAAGACAAACAGCAAGGCTGTTTCAGAAGTTGCCGATTTATTTTCTAAGGAAAAG
ACTGTTTTAGCTGAACCAGTTATTGTAGAAGCTATCATTAATCCTGAAAATGAAGAAAAT
GAGGAAAATAATCCTTTCATTGATGAAAATATGACTGCAAAATAGAAAAAAGAAAAGGAT
GATAGAACTGTTTTTGTTGGTAACATCTCCTTAGAAGCTACTGGTAGTTAAATTGCTAAA
GAGTTTAAACAATACGGAAAAATTGAAAAGATTTGGATTAGATCAGTCCCAGTTGAAAAC
TCAAAAATGCCTAAAAGAGCTAGTGTTATCCTCAAAAAGTTTAAGGATGGTGCTGATAGA
AAGAATGCTTACATTCTATTTTCTACATAAGAAGAAGCTGAAAAGTCACTTGAAGCTAAT
GGAAAGGTATTTTTGGAAAAGCACTTGAGAGTAGATAAAGCAAATGAAAAAATATTGGAT
TACACCAGAACTATATTTGTTGGTAACTTGCACTTTAAGATTTCTGAAGAATAGCTTAGA
CATCATTTTGAAAGCTGTGGTGATATCTTGAACGTAAGAGTTATCAGAGATCCTAAAACT
CATGAAGGAAAAGGATTTGGTTATGTTTTCTTTAAGGAAAAGACTGGATTCTAAAATGCT
TTAGAAAAAAATGGAACTAAACTCCTTGAAAGAGAAATTAGAGTTAAAAAAGCCGTCCCT
GCAGAGAGACTTGAAAAGAAAAAAGTTAGAAAAGCTGAAAAGGCTAACATTATAAATAAG
GAACATGCTATTTAAAGATTAAAAAGTAAATTGAAAGGTAAAGCCGTTGTTCATGACCAA
GATGATTCCGATGATGAGTAAGAATAGCCTAAGGTTAAAAAAGTAAAGAAGGGTATTCAA
AAAAACGACACTATTCCTACAAAGAACTTTGAAAAGAATATGAAGACAACTAACTTTAAA
GAAAACGAAAATGAAATTTTCGACTTTAAAAATGAAATGTCTATTGCTCCTAGAGTCTTG
AGAAAGAAAATTAAAAAACTTAGCAAAAAGGGAATTGAATCAACTGAAGCTTTTTCAAAG
GTTTAGCAACTTAAGAAAAATAAAAAGATTAGCAACGATAAAAATATCTTTAATTCTAAA
TTCACTCTTTAAGCTAGAAAAGATAAAAGATTCAAAAAAGCCATGCAAAATAAGAAAAAA
GGTAAATTAGAAGTAAAGAAAGAAGATAGAAAAGACAAAAAGAAAAAAACAACAACAGCA
GCAGCCTCCACAGCTAAGAAATAAACTAATTAATGA


>TTHERM_00756450(gene)
ATGAGCGGAACTTTAGGATATTTATTATAGCAAAGTGCTTAAAATCAAGGAAAAAAATCC
AATGAAAAGACAAACAGCAAGGCTGTTTCAGAAGTTGCCGATTTATTTTCTAAGGAAAAG
ACTGTTTTAGCTGAACCAGTTATTGTAGAAGCTATCATTAATCCTGAAAATGTAATTATT
TTGATACTCCTACAATTAAATAAAATCAATTTAAAAATCTAAATTATTCTGTTTTTTTAT
TTAGGAAGAAAATGAGGAAAATAATCCTTTCATTGATGAAAATATGACTGCAAAATAGAA
AAAAGAAAAGGATGATAGAACTGTTTTTGTTGGTAACATCTCCTTAGAAGCTACTGGTAG
TTAAATTGCTAAAGAGTTTAAACAATACGGAAAAGTAAAATAAAAATATGAAATTACAAT
ATATAAAAAAATTATTTTTTAATAGATTGAAAAGATTTGGATTAGATCAGTCCCAGTTGA
AAACTCAAAAATGCCTAAAAGAGCTAGTGTTATCCTCAAAAAGGTAATTTATAAAATAGC
AAATTAAAAATTATTTTAGGCGTATTCAACTTACTATTTACAAATTCTTAAAAGTTTAAG
GATGGTGCTGATAGAAAGAATGCTTACATTCTATTTTCTACATAAGAAGAAGCTGAAAAG
TCACTTGAAGCTAATGGAAAGGTATTTTTGGAAAAGCACTTGAGAGTAGATAAAGCAAAT
GAAAAAATAGTAAATAGATATAATACTTATTAATAGCAATATAAATAATATTATAATTAT
TAAAATACAAGTTGGATTACACCAGAACTATATTTGTTGGTAACTTGCACTTTAAGATTT
CTGAAGAATAGCTTAGACATCATTTTGAAAGCTGTGGTGATATCTTGAACGTAAGAGTTA
TCAGAGATCCTAAAACTCATGAAGGAAAAGGATTTGGTTATGTTTTCTTTAAGGAAAAGA
CTGGATTCTAAAATGCTTTAGAAAAAAATGGAACTAAACTCCTTGAAAGAGAAATTAGAG
TTAAAAAAGCCGTCCCTGCAGAGAGACTTGAAAAGAAAAAAGTTAGAAAAGCTGAAAAGG
CTAACATTATAAATAAGGAACATGCTATTTAAAGATTAAAAAGTAAATTGAAAGGTAAAG
CCGTTGTTCATGACCAAGATGATTCCGATGATGAGTAAGAATAGCCTAAGGTTAAAAAAG
TAAAGAAGGGTATTCAAAAAAACGACACTATTCCTACAAAGAACTTTGAAAAGAATATGA
AGACAACTAACTTTAAAGAAAACGAAAATGAAGTACTTACTAAATTTAATTTATTGCCAA
GTATAATACAAATAAAAAATTATAAAAAAATAGATTTTCGACTTTAAAAATGAAATGTCT
ATTGCTCCTAGAGTCTTGAGAAAGAAAATTAAAAAACTTAGCAAAAAGGTATTATAAATA
TTGAATTTTAAATTGAGAAAATTAATTTTTATTTATAATAAATTAGGGAATTGAATCAAC
TGAAGCTTTTTCAAAGGTTTAGCAACTTAAGAAAAATAAAAAGATTAGCAACGATAAAAA
TATCTTTAATTCTAAATTCACTCTTTAAGCTAGAAAAGTAATTAATTCGCTTAAATTTTT
ATTGATAAATATAATAATAATATTTTACTCGTAATTTAAAACAGGATAAAAGATTCAAAA
AAGCCATGCAAAATAAGAAAAAAGGTAAATTAGAAGTAAAGAAAGAAGATAGAAAAGACA
AAAAGAAAAAAACAACAACAGCAGCAGCCTCCACAGCTAAGAAATAAACTAATTAATGA


>TTHERM_00756450(protein)
MSGTLGYLLQQSAQNQGKKSNEKTNSKAVSEVADLFSKEKTVLAEPVIVEAIINPENEEN
EENNPFIDENMTAKQKKEKDDRTVFVGNISLEATGSQIAKEFKQYGKIEKIWIRSVPVEN
SKMPKRASVILKKFKDGADRKNAYILFSTQEEAEKSLEANGKVFLEKHLRVDKANEKILD
YTRTIFVGNLHFKISEEQLRHHFESCGDILNVRVIRDPKTHEGKGFGYVFFKEKTGFQNA
LEKNGTKLLEREIRVKKAVPAERLEKKKVRKAEKANIINKEHAIQRLKSKLKGKAVVHDQ
DDSDDEQEQPKVKKVKKGIQKNDTIPTKNFEKNMKTTNFKENENEIFDFKNEMSIAPRVL
RKKIKKLSKKGIESTEAFSKVQQLKKNKKISNDKNIFNSKFTLQARKDKRFKKAMQNKKK
GKLEVKKEDRKDKKKKTTTAAASTAKKQTNQ