Identifiers and Description

Gene Model Identifier

TTHERM_00756470

Standard Name

IMA9 (Importin Alpha 9)

Aliases

PreTt18310 | 123.m00129 | 3742.m00059

Description

IMA9 armadillo/beta-catenin repeat protein; Armadillo/beta-catenin-like repeat family protein; Karyopherin/Importin alpha family member

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF00514 ) Armadillo/beta-catenin-like repeat

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_15409.1 9.997093137033517e-262
Description: armadillo/beta-catenin repeat family protein (464 aa)
Oxytricha Contig20249.0.g40 4.998978211117678e-38
Description: Armadillo/beta-catenin-like repeat
DictyBase DDB_G0273595 2.9995979253168707e-35
Description: DDB_G0273595 on chromosome: 2 position 3154181 to 3155997
SGD YNL189W 9.99893167504554e-35
Description: SRP1 Karyopherin alpha homolog, forms a dimer with karyopherin beta Kap95p to mediate import of nuclear proteins, binds the nuclear localization signal of the substrate during import; may also play a role in regulation of protein degradation
WormBase WBGene00002074 3.00033207980219e-32
Description: locus:ima-3 Importin subunit alpha-3 status:Confirmed UniProt:Q19969 protein_id:CCD70435.1
Stentor Coeruleus SteCoe_15530 3.1391327920480296e-17
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18676955: Malone CD, Falkowska KA, Li AY, Galanti SE, Kanuru RC, LaMont EG, Mazzarella KC, Micev AJ, Osman MM, Piotrowski NK, Suszko JW, Timm AC, Xu MM, Liu L, Chalker DL (2008) Nucleus-specific importin alpha proteins and nucleoporins regulate protein import and nuclear division in the binucleate Tetrahymena thermophila. Eukaryotic cell 7(9):1487-99

Sequences

>TTHERM_00756470(coding)
ATGGATAAAGTCCCCTGTGATCCAAGTTTACTGGAAAACTATAAAAATGAGATAATGAAT
TCTGAAATAGATACAGAAACAAAGAGGAGAATCATTTGCCAAACAAAGATATGGACTTCT
CTCAACGAAAATCCTCCAATATAATTAATATTGGAGAGTGATATAATTTAGGCATTACTT
CTATACAGTGAAGACGAATTATGTGATCCTAAGATGCTATTTGATATCGTTTGGATATTT
GGAAATATTTGTTCCTGTTCCTCTGATGAAGTAAAATACATGCTTACTCTTGGGGTTGAT
GATTTTTTTATAGAAAATTTAGAAAACTAAATTACTTAAATAGTGGAATTAGCAATGTGG
GGACTTGGAAATATAGCTGGTGATAACCCTAAGAGTAGAGATGTTCTTTTGTTTAAAGAA
ATTGTACCTAAATTGGTTAAAATATTAAATTCAGTTGATTAAAAAAAGAATTTAAAGGAA
TCTTTTTTTCAAACATTTTGTTGGCTAGTATCTTAACTTGTAAGAGGTAAACCAAGCGCT
TAGCCTCAGCATATTTCAGACATCTTACCCATTTTTAGGGAATTGTTGTTCTTAAATAAA
AGATATCTCTATCCTGATATTTTATGGGGATTGTCATACGTTACTGATGAAGATGAGACT
GTTGCAAATATAATTTCTGATTCTCCAATTTTTGATAAATTAACAGAGTTAATTGATTTA
TCTTTTGGATTTACAATTAATCACCCTTCGATAAGGATAATAGCCAACTTAGCTTCTTCA
AGCGAGAATATTACAGATAAGCTGATTAATAGTGGATTAATTCAGTAGTTAATAATTCAT
TTTTTAGAATATAATCCTGAATATACTATTATAAGGAAAGAAGTTTGCTGGTGTCTTAGT
AATATTGCTGCAGGAACATTATAGTAGGCTAAAAGCTTGATTGTGATGGGAGAAATGACT
GAAAAATTAAAAAGATTGCTTAGATACAAAAAAGATCCTGAAGTATAAAAAGAAACTATG
TGGATAATTACGAATTTATCGAATCATCAAGACTCTGATATTTTTAAGTATTTGTTAGAT
AACGACATTTTTGCTGTCTTTACTAGCGAAATAAATTCAGGAGATAAAAAAATGATAGAA
TTATTTTTATAGAATACAACTTAAGTAATCAAATTTTTAAACAAGATATCTAAAGATACT
TTTAGCGCTCAAGAATTAGAAAAACTTGTACTACTTCTTCACTATATTGAAACAACTATT
TAAAATATTAAGCCTATGATAGTAACTGGATAAATAAGATAATAATGTAAGGATATAAAG
GATTCTATTTAAAAAATCAATAAAAAGTTTAATCTTCCATAAAATTTAGAATAAAAGGTT
GCTTAAAATTGA


>TTHERM_00756470(gene)
ATGGATAAAGTCCCCTGTGATCCAAGTTTACTGGAAAACTATAAAAATGAGATAATGAAT
TCTGAAATAGATACAGAAACAAAGAGGAGAATCATTTGCCAAACAAAGATATGGACTTCT
CTCAACGAAAATCCTCCAATATAATTAATATTGGAGAGTGATATAATTTAGGCATTACTT
CTATACAGTGAAGACGAATTATGTGATCCTAAGATGCTATTTGATATCGTTTGGATATTT
GGAAATATTTGTTCCTGTTCCTCTGATGAAGTAAAATACATGCTTACTCTTGGGGTTGAT
GATTTTTTTATAGAAAATTTAGAAAACTAAATTACTTAAATAGTGGAATTAGCGTAAAAA
CATAAACTTCACATCTTATAAAAGTTTAGAAATATATTTTTATTTATTATTAAAAAGAAT
GTGGGGACTTGGAAATATAGCTGGTGATAACCCTAAGAGTAGAGATGTTCTTTTGTTTAA
AGAAATTGTACCTAAATTGGTTAAAATATTAAATTCAGTTGATTAAAAAAAGAATTTAAA
GGAATCTTTTTTTCAAACATTTTGTTGGCTAGTATCTTAACTTGTAAGAGGTAAACCAAG
CGCTTAGCCTCAGCATATTTCAGACATCTTACCCATTTTTAGGGAATTGTTGTTCTTAAA
TAAAAGATATCTCTATCCTGATATTTTATGGGGATTGTCATACGTTACTGATGAAGATGA
GACTGTTGCAAATATAATTTCTGATTCTCCAATTTTTGATAAATTAACAGAGTTAATTGA
TTTATCTTTTGGATTTACAATTAATCACCCTTCGATAAGGATAATAGCCAACTTAGCTTC
TTCAAGCGAGAATATTACAGATAAGCTGATTAATAGTGGATTAATTCAGTAGTTAATAAT
TCATTTTTTAGAATATAATCCTGAATATACTATTATAAGGAAAGAAGTTTGCTGGTGTCT
TAGTAATATTGCTGCAGGAACATTATAGTAGGTAATTAATTTTGTCATATATTTATTTAT
TTTTTAAATTTAAAATTTTTCTTAAGGCTAAAAGCTTGATTGTGATGGGAGAAATGACTG
AAAAATTAAAAAGATTGCTTAGATACAAAAAAGATCCTGAAGTATAAAAAGAAACTATGT
GGATAATTACGAATTTATCGAATCATCAAGACTCTGATATTTTTAAGTATTTGTTAGATA
ACGACATTTTTGCTGTCTTTACTAGCGAAATAAATTCAGGAGATAAAAAAATGATAGAAT
TATTTTTATAGAATACAACTTAAGTAATCAAATTTTTAAACAAGATATCTAAAGATACTT
TTAGCGCTCAAGAATTAGAAAAACTTGTACTACTTCTTCACTATATTGAAACAACTATTT
AAAATATTAAGCCTATGATAGTAACTGGATAAATAAGATAATAATGTAAGGATATAAAGG
ATTCTATTTAAAAAATCAATAAAAAGTTTAATCTTCCATAAAATTTAGAATAAAAGGTTG
CTTAAAATTGA


>TTHERM_00756470(protein)
MDKVPCDPSLLENYKNEIMNSEIDTETKRRIICQTKIWTSLNENPPIQLILESDIIQALL
LYSEDELCDPKMLFDIVWIFGNICSCSSDEVKYMLTLGVDDFFIENLENQITQIVELAMW
GLGNIAGDNPKSRDVLLFKEIVPKLVKILNSVDQKKNLKESFFQTFCWLVSQLVRGKPSA
QPQHISDILPIFRELLFLNKRYLYPDILWGLSYVTDEDETVANIISDSPIFDKLTELIDL
SFGFTINHPSIRIIANLASSSENITDKLINSGLIQQLIIHFLEYNPEYTIIRKEVCWCLS
NIAAGTLQQAKSLIVMGEMTEKLKRLLRYKKDPEVQKETMWIITNLSNHQDSDIFKYLLD
NDIFAVFTSEINSGDKKMIELFLQNTTQVIKFLNKISKDTFSAQELEKLVLLLHYIETTI
QNIKPMIVTGQIRQQCKDIKDSIQKINKKFNLPQNLEQKVAQN