Identifiers and Description

Gene Model Identifier

TTHERM_00760190

Standard Name

MPK2 (Mitogen-activated Protein Kinase )

Aliases

PreTt18504 | 125.m00068 | 3672.m00001 | XP_001031635.2

Description

MPK2 MAP kinase; Putative ERK1/2 subfamily mitogen-activated protein (MAP) kinase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF06293 ) Lipopolysaccharide kinase (Kdo/WaaP) family
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18964.1 9.997093137033517e-262
Description: protein kinase domain-containing protein (427 aa)
Oxytricha Contig21734.0.g77 6.999793971601071e-169
Description: Protein kinase domain
DictyBase DDB_G0286353 8.998537725811687e-130
Description: erkA on chromosome: 4 position 4355028 to 4356796
SGD YLR113W 5.002059218654967e-104
Description: HOG1 Mitogen-activated protein kinase involved in osmoregulation; acts via three independent osmosensors; mitophagy-specific regulator; mediates the recruitment and activation of RNA Pol II at Hot1p-dependent promoters; localization regulated by Ptp2p and Ptp3p
WormBase WBGene00003401 2.000724368835138e-100
Description: locus:mpk-1 Mitogen-activated protein kinase mpk-1 status:Confirmed UniProt:P39745 protein_id:CAA87057.1
Stentor Coeruleus SteCoe_27926 4.020060215743355e-74
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25286252: Yıldız MT, Arslanyolu M (2014) In silico identification and characterization of the MAPK family members of unicellular model eukaryote Tetrahymena thermophila. European journal of protistology 50(5):538-50
  2. Ref:24858074: Arslanyolu M, Yıldız MT (2014) Cloning, expression and characterization of a gene encoding mitogen activated protein kinase 2 (MPK2) from Tetrahymena thermophila. Gene 546(1):40-9
  3. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00760190(coding)
ATGGAGCATTAGGTGCCTAAAGAAATTATAGAATACTACAAACCATATGAAAACAAGAAA
TCAAATATTAGAGTTTAAAATGTATTGAGTGCCTCTAAATTTGAAATGGACGATAATTAT
AGTATCATAGACTCAATTGGTCAGGGAGCTTATGGTATTGTTGTAGCAGCTAGAGACTTG
AATTGTTAGGACGAAGAGAATAATTTGGTAGCAATCAAAAAAATAGAAAAAGCATTTGAA
CATAAAATATTTACAAAAAGAACATTGAGAGAACTGCGTTTACTTAGATTGCTTAAGCAC
GAAAATATTATCGGCATCAATACATTATTATTACCTAGATCAAGAGAAAAATTTGAAGAT
ATATATGTAGTTTCTGAGTTGATGGAGACAGATTTAGCATCAATTATAAAAAGTGAACAA
CCACTTACTGATGAGCATTGTCAATTCTTCCTATACTAAATCCTTCGTGGTTTAAAATAT
ATACATTCAGCAAAGGTCGTTCATCGTGACTTAAAACCTAGAAATTTGCTTGTAAATTCT
AACTGTGATTTAAAAATTTGTGATTTTGGTTTAGCTAGAACAATTATTCCTGGGCTAAAG
TGTAGAGCTGGTATGCTAACAGATTATGTTGCAACCAGGTGGTATAGAGCCCCAGAACTT
CTTTTATCTTGGAGAGACTATGATGAAAAAGTTGATGTCTGGTCGGTAGGTTGTATTTTT
GCAGAACTATTGAGAAGAAAACCATTTTTACCAGGAATAGATACAAGAAATCAAATAGAG
CTTATTTTTGAGTATCTGGGTACTCCTAGTGAATAAGAAATAAATAATATTCCAAGAGAA
AAGTTTAGAAAAATGGTTAAAAACATGCCTAAGAGATAGCCAAAGCAGTTTGAAAAATTA
TTCAGCAAAGCCTCAAAAGAAGCAATTGATTTACTTAGAAAACTTTTGACTTTTGATTTC
ACAAAAAGAATTACCGTAGATGAAGCTTTAAGCCATCCTTATTTATCTGAATTGCATTTC
CCTGAAGATGAACCAACATGTGAGCCTGTTTCTAAGCTTGATTTTGAATTTGAAGAGCAT
AATCTTACTTTACAGTAATTAAAAGACCTCATATACGAAGAAATATTATATTATCACTAT
CCCTCATTTAAACAAGAATACGAAACTAAAAAAGCAAATGGTTAGTCTCTTATTTCTCAT
ATCATAAATAATGCTAATAGAAATGTGCCTGATCCCCACTCGAGCGATGATGATTAAAGT
GATGATGATGACGAAAATTGA


>TTHERM_00760190(gene)
ATGGAGCATTAGGTGCCTAAAGAAATTATAGAATACTACAAACCATATGAAAACAAGAAA
TCAAATATTAGAGTTTAAAATGTATTGAGTGCCTCTAAATTTGAAATGGACGATAATTAT
AGTATCATAGACTCAAGTAGGCATTATTATTTCATATTCCAAACACATGAGTTTTCTATC
AATTAGTTAATTCCCTAATTTCACAAAATCTTTTTTTAAGTCTGATTTTTTTAATGTGGA
ATAAAGTAGATTTTCATAAAATAGAAGCTAAACAAAAAGCTTGATGCAATCATTATTTTT
AATAACTTTCATATATAAATAATAATTAAAATATAGTTGGTCAGGGAGCTTATGGTATTG
TTGTAGCAGCTAGAGACTTGAATTGTTAGGACGAAGAGAATAATTTGGTAGCAATCAAAA
AAATAGAAAAAGCATTTGAACATAAAATATTTACAAAAAGAACATTGAGAGAACTGCGTT
TACTTAGATTGCTTAAGCACGAAAATGTAAAAATATTATGAAATTTGAAAACAAATCAGC
TCAATTTAGAGTTAATTAAAAAAATCAAAACATTAAGTTTTATAATTATTCGCGCAATAC
AGACATAGCCCGACTAAATTGAAAAAAAGATATTTGTTTATTCCAAATTAAATTTGTTAT
ATAATATTTTATTGTTAAATTATAGATTATCGGCATCAATACATTATTATTACCTAGATC
AAGAGAAAAATTTGAAGATATGTAAATAATGGCTTTTACTTTATCATTTCTTGCTTCAAT
TTATTTATAGGCAATAAAGCTATTTTGATTTTGTTTGTTTGTTAAGTTTTTGCTAATCAA
ACTTAAAGGAGAAATAAATAATAGCAAGCTGATTAACTAAAAAGCAATTAATAGAGAGAA
AATGTAAAATTAAATTCTTTTTTAAATGATAGATATGTAGTTTCTGAGTTGATGGAGACA
GATTTAGCATCAATTATAAAAAGTGAACAACCACTTACTGATGAGCATTGTCAATTCTTC
CTATACTAAATCCTTCGTGGTTTAAAATATATACATTCAGCAAAGGTCGTTCATCGTGAC
TTAGTATGCAAAATTTGATTTATTTAACAATTCAAAGTGGGTTACTAGATATATTTTTTG
AAATTTTTATAAAATTTATCTTAAAATTTAATTTAAAAATGCTTTAAGAAAATAATAAAT
TTTCTCTTTTTGATAAATAAATCTAGTTTACTTTGCTAAAAATCCAATTTAAAAAGTATT
TTTGATCTAAATTTTCAAAATTAATTTCATTTATTTAATTAATATTTTTATTAATCATTA
TTATTTGTATCAGAAACCTAGAAATTTGCTTGTAAATTCTAACTGTGATTTAAAAATTTG
TGATTTTGGTTTAGCTAGAACAATTATTCCTGGGCTAAAGTGTAGAGCTGGTATGCTAAC
AGATTATGTTGCAACCAGGTGGTATAGAGCCCCAGAACTTCTTTTATCTTGGAGAGACTA
TGATGAAAAAGGTACTTTCACTTTTCAAAACAAGAAAAAATTGAATATTTTTGCATTAAA
AATAAAAAATAGTTGATGTCTGGTCGGTAGGTTGTATTTTTGCAGAACTATTGAGAAGAA
AACCATTTTTACCAGGAATAGATAGTAAAAAATAAACTAAATTACTTTCTTAAAATACTT
AAATAAAATTAATTTAAAATAAACAGCAAGAAATCAAATAGAGCTTATTTTTGAGTATCT
GGGTACTCCTAGTGAATAAGAAATAAATAATATTCCAAGAGAAAAGTTTAGAAAAATGGT
TAAAAACATGCCTAAGAGATAGCCAAAGCAGTTTGAAAAATTATTCAGCAAAGCCTCAAA
AGAAGGTAAAACCAGATATTAAATATTTAAATTATCTACTTAAATCAAATTAAATTGTAT
AAAAAAAGCAATTGATTTACTTAGAAAACTTTTGACTTTTGATTTCACAAAAAGAATTAC
CGTAGATGAAGCTTTAAGCCATCCTTATTTATCTGAATTGCATTTCCCTGAAGATGAAGT
GAGAATTTAACTTATTCTTAATTTATAAATTAACTTATATTTTTAATTTCATAAAAATAT
ATTTTCTTATTAAAAATAGCCAACATGTGAGCCTGTTTCTAAGCTTGATTTTGAATTTGA
AGAGCATAATCTTACTTTACAGTAATTAAAAGGTAAAATAATAACAAGTAAATTTGTTTC
TAAAATATTTTATTGAAAAATAGACCTCATATACGAAGAAATATTATATTATCACTATCC
CTCATTTAAACAAGAATACGAAACTAAAAAAGCAAATGGTTAGTCTCTTATTTCTCATAT
CATAAATAATGCTAATAGAAATGTGGTAAACAATATTTTCATTAAAAACAAAAAACCAAA
TTAACAATAACATATTAAAAGCCTGATCCCCACTCGAGCGATGATGATTAAAGTGATGAT
GATGACGAAAATTGA


>TTHERM_00760190(protein)
MEHQVPKEIIEYYKPYENKKSNIRVQNVLSASKFEMDDNYSIIDSIGQGAYGIVVAARDL
NCQDEENNLVAIKKIEKAFEHKIFTKRTLRELRLLRLLKHENIIGINTLLLPRSREKFED
IYVVSELMETDLASIIKSEQPLTDEHCQFFLYQILRGLKYIHSAKVVHRDLKPRNLLVNS
NCDLKICDFGLARTIIPGLKCRAGMLTDYVATRWYRAPELLLSWRDYDEKVDVWSVGCIF
AELLRRKPFLPGIDTRNQIELIFEYLGTPSEQEINNIPREKFRKMVKNMPKRQPKQFEKL
FSKASKEAIDLLRKLLTFDFTKRITVDEALSHPYLSELHFPEDEPTCEPVSKLDFEFEEH
NLTLQQLKDLIYEEILYYHYPSFKQEYETKKANGQSLISHIINNANRNVPDPHSSDDDQS
DDDDEN