Identifiers and Description

Gene Model Identifier

TTHERM_00760490

Standard Name

CDC73 (Cell Division Cycle 73)

Aliases

PreTt18534 | 125.m00098 | 3672.m00031

Description

CDC73 RNA pol II accessory factor Cdc73 family protein; Member of S.cerevisiae PAF complex

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05179 ) RNA pol II accessory factor,

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18987.1 9.997093137033517e-262
Description: hypothetical protein (395 aa)
Stentor Coeruleus SteCoe_120 5.242885663363464e-22
Description: None
DictyBase DDB_G0274885 2.9990241513684e-21
Description: cdc73 on chromosome: 2 position 4342175 to 4344320
Oxytricha Contig3758.0.2.g53 2.99851380290819e-19
Description: RNA pol II accessory factor, Cdc73 family
SGD YLR418C 7.9993595954329e-16
Description: CDC73 Component of the Paf1p complex; binds to and modulates the activity of RNA polymerases I and II; required for expression of certain genes, modification of some histones, and telomere maintenance; involved in transcription elongation as demonstrated by the G-less-based run-on (GLRO) assay
WormBase WBGene00018064 9.997764199084386e-16
Description: status:Partially_confirmed UniProt:Q9N5U5 protein_id:CCD70582.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00760490(coding)
ATGATAAGAAACAAAAGGCCTAATAAAATAGATCCTTTAGAATTATTAAGGGAGTTCACA
ATAAATAAAAAGGATGTGGTTAAGAAGGATTAGTATTTATTTTTTGATCAAACCAAACTA
GAGTTAAAAACTCCTACTGCATGGAAGAAGAACACTGGCGGATATTACACTTTGGGAGAT
TTGTGGCTTTTCAATCAAAAGGTTTAGCAAAATATGTCTATGAAACATTATTTCAATTAG
CGTTAATCGTTCGCTCTTGAAGGTATTGACAAAATTGATGAAGATGAAATCAGCAACTAT
TTATAAGGAAAAATTGACAATTCAGATAAAATAGATTAGGAAGCAAAGCAATAGCTTCTT
TCTTCAAGAAAAAGTAAACCAGCAGAATCTTCAGCATTAGAAGGATCTTTGACCAAAAAA
ATTAAAACAAATGATGGAGAAGCAAAGACAGTCGAAATGTAATAAAGAGAAGAATATTTA
AATGCAATTAGTTGGATTATGAAAACTGAAAAGCCACTGACATCTAGAACTCGTATGTTG
AGAAGCAAGTTTAATTCTAACATAAACTTCAAGCATTATATTAAGTAACTTGATGAAGGC
AAGATGACAACTTAAAATAATCCTTTAGAAATAAAATCTACTATTAATTATCCTTGTTTA
TTCAAAGATTTGAGAGATAAGGGTTTAAAGCCTATTATTGTTGTTCCTACTATGGGTAGA
ACAGGAAATATTTCACTATTTAATGCCAAAAAATTCTTAGCAGAAGGTAAATATGAAGAT
CCTGAAAATAAAGATTCTGATAACAGTGAAAGAGTCATTTAAATCGAAAAGAATATAAAG
GGACACAATTTCCTTTTCGAAGTCTACGATAATGTTGGTACATTTGAATCCAAAAATAAT
CCTTCACAAAAATCTAAATGGGAGAGAGTTGTCGGTGTGTTCGTTAGTGGTTAAAAATAT
CAATTCAAAGGATGGCCTAAAGAAGATAATATTCCCAGTATCTTAGATTAAGTTAAAGGC
TTCTATTTAAAATACTACGATATTCCTACTCCAGATTAAGTTGCAAATTGGAATGTTAAA
ATTGTATCAGTATATCGTAATAAAAGACATTTAGATTTCCCAGCTTATGAATAATTTTGG
TAGGAGCTAGAAAATTTTATGATTCAACCAAGAAACAAATAAAAATGA


>TTHERM_00760490(gene)
ATGATAAGAAACAAAAGGCCTAATAAAATAGATCCTTTAGAATTATTAAGGGAGTTCACA
ATAAATAAAAAGGATGTGGTTAAGAAGGATTAGTATTTATTTTTTGATCAAACCAAACTA
GAGTTAAAAACTCCTACTGCATGGAAGAAGAACACTGGCGGATATTACACTTTGGGAGAT
TTGTGGCTTTTCAATCAAAAGGTTTAGCAAAATATGTCTATGAAACATTATTTCAATTAG
CGTTAATCGTTCGCTCTTGAAGGTATTGACAAAATTGATGAAGATGAAATCAGCAACTAT
TTATAAGGAAAAATTGACAATTCAGATAAAATAGATTAGGAAGCAAAGCAATAGCTTCTT
TCTTCAAGAAAAAGTAAACCAGCAGAATCTTCAGCATTAGAAGGATCTTTGACCAAAAAA
ATTAAAACAAATGATGGAGAAGCAAAGACAGTCGAAATGTAATAAAGAGAAGAATATTTA
AATGCAATTAGTTGGATTATGAAAACTGAAAAGCCACTGACATCTAGAACTCGTATGTTG
AGAAGCAAGTTTAATTCTAACATAAACTTCAAGCATTATATTAAGGTATATGTCCAAAGC
AAGATGCTTATTCATTCTATGAAAAAATAGCTTTTAGAAAGCCTTATTATTCATTATTAA
TTCTATGCTTTAAATTTTAAAGCAAATATTTATTTTACAAAACCTAATTTAGAGCTTAAA
TTGCTATTAAGAGAGAGACATAAATTTTAATAAAATTCTGAATTATATCACATGAAAAAA
AAGAATCAAATTTTGATAGAAACTATTGATTTTTAAATATGTGAAATAGTTGTTTTTAGA
TAAATAAAATTGAAAATAAATACATTTTTAACTTATTAAATAAATTATTATAATAAAAGT
AACTTGATGAAGGCAAGATGACAACTTAAAATAATCCTTTAGAAATAAAATCTACTATTA
ATTATCCTTGTTTATTCAAAGATTTGAGAGATAAGGGTTTAAAGCCTATTATTGTTGTTC
CTACTATGGGTAGAACAGGAAATATTTCACTATTTAATGCCAAAAAATTCTTAGCAGAAG
GTAAATATGAAGATCCTGAAAATAAAGATTCTGATAACAGTGAAAGAGTCATTTAAATCG
AAAAGAATATAAAGGGACACAATTTCCTTTTCGAAGTCTACGATAATGTTGGTACATTTG
AATCCAAAAATAATCCTTCACAAAAAGTAATATTGATTTTTTATTTAAAACATCAATTAA
AGTTTTATTTATTTATTTTTATTTTAGTCTAAATGGGAGAGAGTTGTCGGTGTGTTCGTT
AGTGGTTAAAAATATCAATTCAAAGGATGGCCTAAAGAAGATAATATTCCCAGTATCTTA
GATTAAGTTAAAGGCTTCTATTTAAAATACTACGATATTCCTACTCCAGATTAAGTTGCA
AATTGGAATGTTAAAATTGTATCAGTATATCGTAATAAAAGACATTTAGATTTCCCAGCT
TATGAATAATTTTGGTAGGAGCTAGAAAATTTTATGATTCAACCAAGAAACAAATAAAAA
TGA


>TTHERM_00760490(protein)
MIRNKRPNKIDPLELLREFTINKKDVVKKDQYLFFDQTKLELKTPTAWKKNTGGYYTLGD
LWLFNQKVQQNMSMKHYFNQRQSFALEGIDKIDEDEISNYLQGKIDNSDKIDQEAKQQLL
SSRKSKPAESSALEGSLTKKIKTNDGEAKTVEMQQREEYLNAISWIMKTEKPLTSRTRML
RSKFNSNINFKHYIKQLDEGKMTTQNNPLEIKSTINYPCLFKDLRDKGLKPIIVVPTMGR
TGNISLFNAKKFLAEGKYEDPENKDSDNSERVIQIEKNIKGHNFLFEVYDNVGTFESKNN
PSQKSKWERVVGVFVSGQKYQFKGWPKEDNIPSILDQVKGFYLKYYDIPTPDQVANWNVK
IVSVYRNKRHLDFPAYEQFWQELENFMIQPRNKQK