Identifiers and Description

Gene Model Identifier

TTHERM_00763040

Standard Name

MSH5 (Homolog of budding yeast MSH5)

Aliases

PreTt03295 | 126.m00093 | 3740.m00020

Description

MutS domain V protein; Meiotic pro-crossover factor along with MSH4; MutS domain V family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

  • photosynthetic electron transport in photosystem II (IEA) | GO:0009772
  • protein-FMN linkage via 1'-(8alpha-FMN)-L-histidine (IEA) | GO:0050743

Domains

  • ( PF00488 ) MutS domain V
  • ( PF02463 ) RecF/RecN/SMC N terminal domain
  • ( PF08181 ) DegQ (SacQ) family
  • ( TIGR00075 ) hydrogenase expression/formation protein HypD
  • ( TIGR00611 ) DNA replication and repair protein
  • ( TIGR00634 ) DNA repair protein RecN
  • ( TIGR03058 ) chlorosome envelope protein H

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_15991.1 1.0003391709219401e-98
Description: hypothetical protein (920 aa)
WormBase WBGene00003421 1.0000422327488734e-24
Description: locus:msh-5 MutS protein homolog 5 status:Confirmed UniProt:Q19272 protein_id:CAA98059.2
DictyBase DDB_G0284747 6.996829646809514e-23
Description: msh5 on chromosome: 4 position 2423376 to 2426473
Oxytricha Contig18281.0.g80 5.0013199114200274e-20
Description: MutS domain V
SGD YDL154W 2.999758165421992e-18
Description: MSH5 Protein of the MutS family, forms a dimer with Msh4p that facilitates crossovers between homologs during meiosis; msh5-Y823H mutation confers tolerance to DNA alkylating agents; homologs present in C. elegans and humans
Stentor Coeruleus SteCoe_15585 0.0000000000002543665647376923
Description: None

General Information

No. Gene Name(s) Paragraph Text
98 MSH5 Msh5 (together with Msh4) is required for normal chiasma formation
99 MSH5 The gene model is incorrect. Transcript is annotated as gene_000007168 in TFGD

Associated Literature

  1. Ref:28100637: Shodhan A, Kataoka K, Mochizuki K, Novatchkova M, Loidl J (2017) A Zip3-like protein plays a role in crossover formation in the SC-less meiosis of the protist Tetrahymena. Molecular biology of the cell 28(6):825-833
  2. Ref:25217051: Shodhan A, Lukaszewicz A, Novatchkova M, Loidl J (2014) Msh4 and Msh5 function in SC-independent chiasma formation during the streamlined meiosis of Tetrahymena. Genetics 198(3):983-93

Sequences

>TTHERM_00763040(coding)
ATGTGTTAAATAAGTATATTTTAAGAATAGAATAGTTTAGGTGTTAGTTATTATGATCCT
AAATAAAACAGAATATTCTGTTACTAGATAAATATACTAAATGAGGAAGAACATATATAA
AACCTTTTTTTATAGTTTGATAATATATATGCTCTAATAATACCATTAAATTTTAATGAA
AACTTAGTTTAAAGTGTAATAGAAAAATATTTTTTAACACAAAACAGACATTTGAATATT
CAAAGAGTCTTAAATTGTGAATATAATTTTGAAAGTTGCATAAATAAAATCTTGTAATTA
AATTTTGATAAAGATTTAAATTAATCGCTTTAAAATAGCCAAGAAATGACAATCAGTAAA
AACTAACAATCAATATCATTACAATGTGATGAGAACTTCAAAAATCGAAACAATAAAAAA
TATCTAACTCTTTGCTAATAAATAGACATAGAGTAAAAAAACTTAATAAAATCATTAGGT
GGGTTATTATGCTTCCTGTTCAATAATTAGATTATTAATTTGAATTATTCGTTTTTTGAC
ATAGTATTTCTTAAAAACATAAATAATTAAATACATTACAATCAATACACTCTAAGTTAT
TTGAATATATTTAAAGAAGACATTCATCCATCAATGATTAAAGGTAAAGGTTAAGCTAAA
GAAGGTTTTTCTTTGTTTTTACTATTCTCAAAATTTGTATACACTAAATTAGGACTGATT
AAATTAAAGCACCTATTTTTAACTCCTTCATTTGATTTGAAAACTCTATAATTAAGAAAT
CAGTCAATAGATTTTTTTTATTCTTAATCTGGAGAAAGCATTAAGAAAATTAAACTCAAC
CTCTAAAAGTGTTCAAATATTAAAAAAGTTCTAAGTAAATTGAAATAAGTACAAATGAAT
TTTAATGATTGGTATAGCTTTAAAATTACGCTGCAAAGCACATTAAACATAATGTAATTA
TTTTTAATATAAAATGAAATACTTAAAAACCGAAAACTTTTAGTATTTCAGAATCTATCA
GATTATTTATTTTAAGAACTACAAAAATTGAATTCTTTTTTAGAAAAATATCTATTGTTC
TCACCAAAAGATGGTGAAATTATGATAAGAGAAGGTATAGTATAAGAATTAGATGATCTT
TTAAAAATATATGATAATTTAGATGAAATTTTAAGTTATTATAATAGTTAAGAAATAATT
AAACTGACTAATAATAATTCGAATTTCAACTCTTAGATGATGATTTAATATTTTCCATAA
CTAGGATTTTTCATAACTATACAAAACTCTAATTAATTCAATAATCAAGTATAGGTCGAT
GATAAGGTTAACTTCTCTTAAAATAAAAGCTATCAGGATCAGTAAAACAATTATTCATTA
GAATAAGATTGCTGTGAAAATTCAAAAGAACAAAAACAGAATGCTTTGAAAAGTGATAAA
AGTTTTTATCAGGATGGGAAATAATTAGATGACGATGAAGTTGAGGAAAAATAAAATTAA
AGCTAGTAAAATTTAAAAAGAACCAGGAGCAGTAATAGTCTTTCTTCTAAAAATTAAGGA
ATAGAAAATTCCTAGAATTTATAATAATAATACTGTTTAACTAATGACTACTCTTACTGT
TTCACACTATAAGATGCTCTTTTATTTAAAAACGATTTATGTAACTAACTAGATTTAAAA
TATGGAGATATTCAAAGCAGAATAATTGATATATAAAGAGATATAGTAAGAGAAATAGAA
CAATAAATTTTGTTATACAGTGAAGAAATAAATGCAGCTTAAGAATTTATAAGCGATCTA
GATCTTTTTTTTTGTTTGTATCAAGCTGCTGAAGTATATAATTTAAGAAAACCTAAACTT
ACAAATGATTCTTCATTAGTTTTTTAAGAAATGAGGAATATATTAACAGAAATAACAATA
GGTGAAAAATAATTTATTTCTAACAGTTTTTGTGTTCACAATTTTGCTCAATATATGAAG
AACTAAAAAATATAAACTAATAATTTTTTAGATTCCTAGTTTAGTAATAGATTTACATTT
ATAACAGGTCCTAATTATGCAGGCAAAAGTGTTTTCTTAAAAAGTATCGGAATGATTACC
TATCTTGCTCATATTGGTAGCTTTATTCCTTGCAGATTTGCCAGAATAGGAATGATAGAT
AATATTTTTGTAAATACTTGCTAACATGATTCAGTTCTAAAATTCAATGGAGAGTCAGCA
TAGCAACTTTAATTCATAAACTACATTTTAAACTAAGCTACTAATAGAACTTTAATACTC
ATAGATGAATTCGGAAAAAATTTCAGGCTTAACGATAGTTTAAATTTAAATTACTCCCTA
GTTAAGTGCTTGACAGAAGATACATTCTAAGGTTTAAATGAAAAAATAACTTAAAAATAA
CATCCTTCTTTGTAATAAGAAGATAATGATTAAAACATTTTTTATTAATATTAAACTGAT
AATTCTTAAGTGGAAAATATTGATGAAATAAAATAGTAAAATTTGAGAGGTTTGAATGAG
TTTCAGTTTATACATTAAGACATTTAAAATGTTAATTTAATGGAACAATACAATAAAATT
CCTATCACTCTGATGGCAAGCCACTTAAGTTAGCTTGTTAATTTGTGTGGACTGAGAGAA
AACTATATAATTAGATTTGCATAAATGGAAGTATTAATATAATAAGGAAAAAATGTTTGC
AAACTTAATGAATTAAAGGAGAATATTAATGCTATGCAGAAGATTGTTCATGTATATAAA
CTAAATAAAGGTTTATCCTTAAAAAGTTGCTCCTCATTAGTTGCTAAGAATATTTTCAGA
GATAATGAATATCTTATTCATAGAATTAATGAAATAAATTAATTTATTTTAGAAGGAAAA
TTTTAAGTCTCGCCATAATAAAATGTTGAATAAATTCATCTTGAAAAGGTTTAAAAAGTT
ATAAATATTTTAAATTCTTTGAAAGAGTAATAAATTTAATGA


>TTHERM_00763040(gene)
ATGTGTTAAATAAGTATATTTTAAGAATAGAATAGTTTAGGTGTTAGTTATTATGATCCT
AAATAAAACAGAATATTCTGTTACTAGATAAATATACTAAATGAGGAAGAACATATATAA
AACCTTTTTTTATAGTTTGATAATATATATGCTCTAATAATACCATTAAATTTTAATGAA
AACTTAGTTTAAAGTGTAATAGAAAAATATTTTTTAACACAAAACAGACATTTGAATATT
CAAAGAGTCTTAAATTGTGAATATAATTTTGAAAGTTGCATAAATAAAATCTTGTAATTA
AATTTTGATAAAGATTTAAATTAATCGCTTTAAAATAGCCAAGAAATGACAATCAGTAAA
AACTAACAATCAATATCATTACAATGTGATGAGAACTTCAAAAATCGAAACAATAAAAAA
TATCTAACTCTTTGCTAATAAATAGACATAGAGTAAAAAAACTTAATAAAATCATTAGGT
GGGTTATTATGCTTCCTGTTCAATAATTAGATTATTAATTTGAATTATTCGTTTTTTGAC
ATAGTATTTCTTAAAAACATAAATAATTAAATACATTACAATCAATACACTCTAAGTTAT
TTGAATATATTTAAAGAAGACATTCATCCATCAATGATTAAAGGTAAAGGTTAAGCTAAA
GAAGGTTTTTCTTTGTTTTTACTATTCTCAAAATTTGTATACACTAAATTAGGACTGATT
AAATTAAAGCACCTATTTTTAACTCCTTCATTTGATTTGAAAACTCTATAAGTAATTTTT
ATTTTTACATTTTAAATATCATAATACTATTTCGGAATTAGACTTAAATTTATGATAATT
TATTACTTATATTTTAATTAAAATCAAGTTAAGAAATCAGTCAATAGATTTTTTTTATTC
TTAATCTGGAGAAAGCATTAAGAAAATTAAACTCAACCTCTAAAAGTGTTCAAATATTAA
AAAAGTTCTAAGTAAATTGAAATAAGTACAAATGAATTTTAATGATTGGTATAGCTTTAA
AATTACGCTGCAAAGCACATTAAACATAATGTAATTATTTTTAATATAAAATGAAATACT
TAAAAACCGAAAACTTTTAGTATTTCAGAATCTATCAGATTATTTATTTTAAGAACTACA
AAAATTGAATTCTTTTTTAGAAAAATATCTATTGTTCTCACCAAAAGATGGTGAAATTAT
GATAAGAGAAGGTATAGTATAAGAATTAGATGATCTTTTAAAAATATATGATAATTTAGA
TGAAATTTTAAGTTATTATAATAGTTAAGAAATAATTAAACTGACTAATAATAATTCGAA
TTTCAACTCTTAGATGATGATTTAATATTTTCCATAACTAGGATTTTTCATAACTATACA
AAACTCTAATTAATTCAATAATCAAGTATAGGTCGATGATAAGGTTAACTTCTCTTAAAA
TAAAAGCTATCAGGATCAGGTATAGATATTTTTTTAAAAGTTTATTATATTAAAATTTAT
AAAATTAAAAAAAGTAAAACAATTATTCATTAGAATAAGATTGCTGTGAAAATTCAAAAG
AACAAAAACAGAATGCTTTGAAAAGTGATAAAAGTTTTTATCAGGATGGGAAATAATTAG
ATGACGATGAAGTTGAGGGTATATTGAAATATAATTAAATATTAATATATCAATCATATT
ATAATTAATTAAAAATAATAGAAAAATAAAATTAAAGCTAGTAAAATTTAAAAAGAACCA
GGAGCAGTAATAGTCTTTCTTCTAAAAATTAAGGAATAGAAAATTCCTAGAATTTATAAT
AATAATACTGTTTAACTAATGACTACTCTTACTGTTTCACACTATAAGATGCTCTTTTAT
TTAAAAACGATTTATGTAACTAACTAGATTTAAAATATGGAGATATTCAAAGCAGAATAA
TTGATATATAAAGAGATATAGTAAGAGAAATAGAACAATAAGTAAATTTTTTTTCTTTTA
TTTTGATTGATTAAATAAACTTAATTAAAATAAAAGATTTTGTTATACAGTGAAGAAATA
AATGCAGCTTAAGAATTTATAAGCGATCTAGATCTTTTTTTTTGTTTGTATCAAGCTGCT
GAAGTATATAATTTAAGAAAACCTAAACTTACAAATGATTCTTCATTAGTTTTTTAAGAA
ATGAGGAATATATTAACAGAAATAACAATAGGTGAAAAATAATTTATTTCTAACAGTTTT
TGTGTTCACAATTTTGCTCAATATATGAAGAACTAAAAAATATAAACTAATAATTTTTTA
GATTCCTAGTTTAGTAATAGATTTACATTTATAACAGGTCCTAATTATGCAGGCAAAAGT
GTTTTCTTAAAAAGTGTAACTTATAATAAATATCACTTTACTTTTAATTGAAATTTATTC
TTTAATTTTTACAATTAAGTTATTCATAAATTTTAAGTTCCAAATAAATAAGTTATATAA
TTGCAATAAATGTTTACATATTTATAAAATTTACTATCCAATAGATCGGAATGATTACCT
ATCTTGCTCATATTGGTAGCTTTATTCCTTGCAGATTTGCCAGAATAGGAATGATAGATA
ATATTTTTGTAAATACTTGCTAACATGATTCAGTTCTAAAATTCAATGGAGAGTCAGCAT
AGCAACTTTAATTCATAAACTACATTTTAAACTAAGCTACTAATAGAACTTTAATACTCA
TAGATGAATTCGGAAAAAGTAATTTAATCAATAAACTGTATTTAAAACTTATTCTATTTT
GTATAGATTTCAGGCTTAACGATAGTTTAAATTTAAATTACTCCCTAGTTAAGTGCTTGA
CAGAAGATACATTCTAAGGTTTAAATGAAAAAATAACTTAAAAATAACATCCTTCTTTGT
AATAAGAAGATAATGATTAAAACATTTTTTATTAATATTAAACTGATAATTCTTAAGTGG
AAAATATTGATGAAATAAAATAGTAAAATTTGAGAGGTTTGAATGAGTTTCAGTTTATAC
ATTAAGACATTTAAAATGTTAATTTAATGGAACAATACAATAAAATTCCTATCACTCTGA
TGGCAAGCCACTTAAGTTAGCTTGTTAATTTGTGTGGACTGAGAGAAAACTATATAATTA
GATTTGCATAAATGGAAGTATTAATATAATAAGGAAAAAATGTTTGCAAACTTAATGAAT
TAAAGGAGAATATTAATGCTATGCAGAAGATTGTTCATGTATATAAACTAAATAAAGGTT
TATCCTTAAAAAGTTGCTCCTCATTAGTTGCTAAGAATATTTTCAGAGATAATGAATATC
TTATTCATAGAATTAATGAAATAAATTAATTTATTTTAGAAGGAAAATTTTAAGTCTCGC
CATAATAAAATGTTGAATAAATTCATCTTGAAAAGGTTTAAAAAGTTATAAATATTTTAA
ATTCTTTGAAAGAGTAATAAATTTAATGA


>TTHERM_00763040(protein)
MCQISIFQEQNSLGVSYYDPKQNRIFCYQINILNEEEHIQNLFLQFDNIYALIIPLNFNE
NLVQSVIEKYFLTQNRHLNIQRVLNCEYNFESCINKILQLNFDKDLNQSLQNSQEMTISK
NQQSISLQCDENFKNRNNKKYLTLCQQIDIEQKNLIKSLGGLLCFLFNNQIINLNYSFFD
IVFLKNINNQIHYNQYTLSYLNIFKEDIHPSMIKGKGQAKEGFSLFLLFSKFVYTKLGLI
KLKHLFLTPSFDLKTLQLRNQSIDFFYSQSGESIKKIKLNLQKCSNIKKVLSKLKQVQMN
FNDWYSFKITLQSTLNIMQLFLIQNEILKNRKLLVFQNLSDYLFQELQKLNSFLEKYLLF
SPKDGEIMIREGIVQELDDLLKIYDNLDEILSYYNSQEIIKLTNNNSNFNSQMMIQYFPQ
LGFFITIQNSNQFNNQVQVDDKVNFSQNKSYQDQQNNYSLEQDCCENSKEQKQNALKSDK
SFYQDGKQLDDDEVEEKQNQSQQNLKRTRSSNSLSSKNQGIENSQNLQQQYCLTNDYSYC
FTLQDALLFKNDLCNQLDLKYGDIQSRIIDIQRDIVREIEQQILLYSEEINAAQEFISDL
DLFFCLYQAAEVYNLRKPKLTNDSSLVFQEMRNILTEITIGEKQFISNSFCVHNFAQYMK
NQKIQTNNFLDSQFSNRFTFITGPNYAGKSVFLKSIGMITYLAHIGSFIPCRFARIGMID
NIFVNTCQHDSVLKFNGESAQQLQFINYILNQATNRTLILIDEFGKNFRLNDSLNLNYSL
VKCLTEDTFQGLNEKITQKQHPSLQQEDNDQNIFYQYQTDNSQVENIDEIKQQNLRGLNE
FQFIHQDIQNVNLMEQYNKIPITLMASHLSQLVNLCGLRENYIIRFAQMEVLIQQGKNVC
KLNELKENINAMQKIVHVYKLNKGLSLKSCSSLVAKNIFRDNEYLIHRINEINQFILEGK
FQVSPQQNVEQIHLEKVQKVINILNSLKEQQIQ