Identifiers and Description

Gene Model Identifier

TTHERM_00772040

Standard Name

PPI13 (peptidylprolyl isomerase 13)

Aliases

PreTt13943 | 127.m00106

Description

PPI13 peptidyl-prolyl cis-trans isomerase cyclophilin-type protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00160 ) peptidyl-prolyl cis-trans isomerase, cyclophilin-type
  • ( PF04564 ) U-box domain
  • ( PF04641 ) Protein of unknown function, DUF602
  • ( TIGR00192 ) urease, beta subunit

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05669.1 9.997093137033517e-262
Description: peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein (555 aa)
Oxytricha Contig19826.0.g53 9.996472444528484e-132
Description: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
WormBase WBGene00000880 7.0000984021781654e-99
Description: locus:cyn-4 Peptidyl-prolyl cis-trans isomerase 4 status:Confirmed UniProt:P52012 protein_id:CAA85417.1
DictyBase DDB_G0269216 6.00092892288903e-46
Description: cypE on chromosome: 1 position 3461467 to 3462395
SGD YML078W 2.00017271388466e-38
Description: CPR3 Mitochondrial peptidyl-prolyl cis-trans isomerase (cyclophilin), catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; involved in protein refolding after import into mitochondria
Stentor Coeruleus SteCoe_27746 2.3195228302435696e-16
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00772040(coding)
ATGGGAAAACATAGACACACTAAAGATCGTATGTTTATTTCATACACCGAGCATAAAATG
GAATGGGGTGGTAAAAAAGATCCAGAAAAAGTTCCTATGAGTAAATTACCATTTTTTTGC
TGTAGTTTGAGCTTAACTCCTTTTAAAAATCCTGTATGTTCTCCAGATGGAATTGTATTT
GATATTATGAGCATCATTCCTTACATAAAAAAGTATAAAAAAAATCCAGTCACAGGCGAG
GATTTAAAAATTAGCGATTTAATTACTTTGAAATTTTCTAAAAATGATAATGGTGAATAT
TAAGATCCAATTTCTTTTAAAGTATTCACTGACCATACTCACATTGTAACAATTAAGACT
TCAGGCAATGTATACAGCTTCGATACAGTTGATAAACTTAACAGAGAAGCAAAGTATTGG
TAAGATTTAATGACTGGAGAAAAATTCACACCAAAAGACATCATAACTTTGAATGATCCT
AAAAATTTAGAAAATAGAACTATCAAAAATTTTGATTATATAAGAAATAATATTGAAGTT
GAATTGAAAGATAAAGGAAATGATGCCTTTATCAATAAGAATGAAGCTACAAAAAATATT
CTTACCAAATATTAAGAAAAACAAAAGTAAGAAAATCTTGAACAGAAAAAGAAAGACGAT
GAAGAAATAGAATAAATTAGGAAATAGAGAAAGGAAGAATTAGAGAAACTTGAAAAAGGA
GAGCAAATTCCTGTTGCTGATTTTATAAAATCAGCTATTAGAAACAGAGATTTCATTCAT
TAGAGAGAAACTACTAGTGATGTTGCTGTCAGTGTTACAAGTACAGCCTCTGCAGTTATG
AGAGAATAAGGAAGTTTAGAATTCAGAAGTTTAAATGAAACAGAAATTAGAAAGATTATT
CATGATTAGGTCAAAAATAAATAAATGAAGGGCTATGTAAATATTATAACTAATATAGGA
GAAATATAATGCATGATTCATGCAAATTTTGTTCCTAAAACATCTGAAAATTTCCTCGAA
TTGTGTGAAAAAGGTTATTATAACGGAATTAAATTCCACAGATTAGTAAAGGACTTCATG
ATTCAAGGAGGAGATCCAACTGGTACTGGAAGAGGTGGCGAGTCAATTTTCGGATATAAA
TTTGAAGATGAATTCCATGCTAAAATTAGACATAGCAAGCCAGGTATTCTAAGTATGGCA
AATTCAGGGCCAAACACAAATGCATCTTAATTCTTTATAACTCTTGGAGAGTGTGCATGG
TTAGATGAGCAGCATAATGCTTTTGGTGAAGTAATTGGAAACCAATTAACCTTACATAAA
ATAAATACCCATCCAGTAAATGGAGAAAAACCAGCAACTCCAATAACTATTGAGAAAATC
ATAGTAGTTGAAAATCCTTTTAGATAAGTCATAGTCAAAATGTAGGAATAAAAAAGAGAA
AAGCTGAAAGAAGAAAAACGTAAAGCTTCAGAAAAAGAAAGAGAGCACGAGAGATGGATT
AGCAATGATGATAAATTTATTTTACCTAAACTTGCTGAAACTGAAGAAAAGCCTAAAATA
AAATCTGCTGGCTTAGCAAGCATGCTTACTGATCCTAAAAATTCAAATTATGATATACTA
CCAAAGGAAAAGCACAGAAAAAATTTTAATTTTTCTGACTGGTGA


>TTHERM_00772040(gene)
ATGGGAAAACATAGACACACTAAAGATCGTATGTTTATTTCATACACCGAGCATAAAATG
GGTAAATTAATAATGTTATTTTAATACTTTTTAACAGTTATTAAGTATGAATAAATTTAT
ATTTTGAAATATTTTTACTTATTAATAATAGAATGGGGTGGTAAAAAAGATCCAGAAAAA
GTTCCTATGAGTAAATTACCATTTTTTTGCTGTAGTTTGAGCTTAACTCCTTTTAAAAAT
CCTGTATGTTCTCCAGATGGAATTGTATTTGATATTATGTAAAATCTACTTGCTTTTTTA
TTATAATTACTTATTTTGATGAATAACTAAATATTAACTTATAATTTATAAAAAGGAGCA
TCATTCCTTACATAAAAAAGTATAAAAAAAATCCAGTCACAGGCGAGGATTTAAAAATTA
GCGATTTAATTACTTTGAAATTTTCTAAAAATGATAATGGTGAATATTAAGATCCAATTT
CTTTTAAAGTATTCACTGACCATACTCACATTGTAACAATTAAGACTTCAGGCAATGTAT
ACAGCTTCGATACAGTTGATAAACTTAACAGAGAAGCAAAGTATTGGTAAGATTTAATGA
CTGGAGAAAAATTCACACCAAAAGACATCATAACTTTGAATGATCCTAAAAATTTAGAAA
ATAGAACTATCAAAAATTTTGATTATATAAGAAATAATATTGAAGTTGAATTGAAAGATA
AAGGAAATGATGCCTTTATCAATAAGAATGAAGCTACAAAAAATATTCTTACCAAATATT
AAGAAAAACAAAAGGTATTTTAATATTTATAATAAATTAATTTTTGAGTTTATTTTAGAG
TTTCTTTAAAATTATATTAATAGTAAGAAAATCTTGAACAGAAAAAGAAAGACGATGAAG
AAATAGAATAAATTAGGAAATAGAGAAAGGAAGAATTAGAGAAACTTGAAAAAGGAGAGC
AAATTCCTGTTGCTGATTTTATAAAATCAGCTATTAGAAACAGAGATTTCATTCATTAGA
GAGAAACTACTAGTGATGTTGCTGTCAGTGTTACAAGTACAGCCTCTGCAGTTATGAGAG
AATAAGGAAGTTTAGAATTCAGAAGTTTAAATGAAACAGAAATTAGAAAGATTATTCATG
ATTAGGTCAAAAATAAATAAATGAAGGGCTATGTAAATATTATAACTAATATAGGAGAAA
TATAATGCATGATTCATGCAAATTTTGTTCCTAAAACATCTGAAAATTTCCTCGAATTGT
GTGAAAAAGGTTATTATAACGGAATTAAATTCCACAGATTAGTAAAGGACTTCATGGTAA
AATAGATTCACGTTTTAAATAATGATTGAAATAAACTTACCTTTATTATTAAAATAGATT
CAAGGAGGAGATCCAACTGGTACTGGAAGAGGTGGCGAGTCAATTTTCGGATATAAATTT
GAAGATGAATTCCATGCTAAAATTAGACATAGCAAGCCAGGTATTCTAAGTATGGCAAAT
TCAGGGCCAAACACAAATGCATCTTAATTGTAATTTAGATAGAATAATTTTTTGGTAGTG
TGAATTAACCTATTTTTTTAAAAAGCTTTATAACTCTTGGAGAGTGTGCATGGTTAGATG
AGCAGCATAATGCTTTTGGTGAAGTAATTGGAAACCAATTAACCTTACATAAAATAAATA
CCCATCCAGTAAATGGAGAAAAACCAGCAGTAAACAAAGTTATTTTGGAATAAATATTTA
ATTAATTTTTTAATAATAAAAAAGACTCCAATAACTATTGAGAAAATCATAGTAGTTGAA
AATCCTTTTAGATAAGTCATAGTCAAAATGTAGGAATAAAAAAGAGAAAAGCTGAAAGAA
GAAAAACGTAAAGCTTCAGAAAAAGAAAGAGAGCACGAGAGATGGATTAGCAATGATGAT
AAATTTATTTTACCTAAACTTGCTGAAACTGAAGAAAAGCCTAAAATAAAATCTGCTGGC
TTAGCAAGCATGCTTACTGATCCTAAAAATTCAAATTATGATATACTACCAAAGGAAAAG
CACAGAAAAAATTTTAATTTTTCTGACTGGTGA


>TTHERM_00772040(protein)
MGKHRHTKDRMFISYTEHKMEWGGKKDPEKVPMSKLPFFCCSLSLTPFKNPVCSPDGIVF
DIMSIIPYIKKYKKNPVTGEDLKISDLITLKFSKNDNGEYQDPISFKVFTDHTHIVTIKT
SGNVYSFDTVDKLNREAKYWQDLMTGEKFTPKDIITLNDPKNLENRTIKNFDYIRNNIEV
ELKDKGNDAFINKNEATKNILTKYQEKQKQENLEQKKKDDEEIEQIRKQRKEELEKLEKG
EQIPVADFIKSAIRNRDFIHQRETTSDVAVSVTSTASAVMREQGSLEFRSLNETEIRKII
HDQVKNKQMKGYVNIITNIGEIQCMIHANFVPKTSENFLELCEKGYYNGIKFHRLVKDFM
IQGGDPTGTGRGGESIFGYKFEDEFHAKIRHSKPGILSMANSGPNTNASQFFITLGECAW
LDEQHNAFGEVIGNQLTLHKINTHPVNGEKPATPITIEKIIVVENPFRQVIVKMQEQKRE
KLKEEKRKASEKEREHERWISNDDKFILPKLAETEEKPKIKSAGLASMLTDPKNSNYDIL
PKEKHRKNFNFSDW