Identifiers and Description

Gene Model Identifier

TTHERM_00773750

Standard Name

DIC4 (Dynein Intermediate Chain 4)

Aliases

PreTt04466 | 128.m00144 | 3676.m00069 | IC74 | IC4

Description

IC4 cytoplasmic dynein intermediate chain; Intermediate chain subunit of non-axonemal dynein complex 1

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF04394 ) Protein of unknown function, DUF536

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17701.1 9.997093137033517e-262
Description: hypothetical protein (600 aa)
Oxytricha Contig3701.0.g57 1.9992560499818233e-109
Description: WD domain, G-beta repeat
DictyBase DDB_G0280849 9.997329401607134e-86
Description: dicA on chromosome: 3 position 3856978 to 3859184
WormBase WBGene00015927 4.0015855602347305e-61
Description: locus:dyci-1 status:Confirmed UniProt:O45087 protein_id:CCD64991.1
Stentor Coeruleus SteCoe_14054 3.720075976020836e-44
Description: None
SGD YDL195W 0.0000000006999585478469937
Description: SEC31 Component of the Sec13p-Sec31p complex of the COPII vesicle coat, required for vesicle formation in ER to Golgi transport; mutant has increased aneuploidy tolerance

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00773750(coding)
ATGAGCAAAAATATTGAAGACTACAAAAAAAAGCTTGAGGAATTAAAAAAAGGTAGAGCA
GCTGCTAGAACAACTGAATAAATAGTAGGAAATGTTTAGACTAGCTAGTAACCTGTTTAA
AATATAGATAAAGAAGAATAAAAGGAAAGCTAGTAAACAAGTTAGAGTCATTTAGATAAT
ATTTCTAATTAACATTAAGAAGCAAGTAGCTCATCCTAAAAGAAACTTAGGACTTTCAAT
TTAGAAATGGATAAATAAGTTATAGAAATTAGCATTCCTCCTAAAGAAAAAATTCATTAT
GAAAGAGAAATTTAATGCGATTTAGAAGTAGAACAACAAACTCATAAACTTTTCCATGGA
ACTGGAAATGAATCAGAAAGCAATTTCCAACATGTTTAAGTGGAAATTGAAAACCCCGAT
GTATTCTAAAATCCTCATCAAGTTTCTTCTTAAATAGCTGCCTCAGCTCATAAAGCATTA
CAATAACCTGTCCTACCTTCTAAAGTTGAATTAACAGGAGAAGACATAAGTCATATTGTA
AAATCTAAAAATTTCCTAGATTTTTTTAATAGAAGTTCTAGATTAATAGAAAAAGCAATT
ACTAACAAAGACGACAGCAATCTCTATGCTTTAATTGATGTTATTGGAGATAAAAGCAAT
TCAAATTTACAATAAACAGGTATCAAAAGTTATTTATAACACTCAGTCAAACTTACTGAT
CAGTAATATGGTACCAACAGAGTAGTTACTGGTATTGAGTGGTCTCCTCATAGAAATGAT
TTAGTTCTAGCTTCTTATTCCCAAAATGAATAAGGAAATATAAATGATCCTGTTGGGTTA
GTTGCTTTGTGGTCTTTATCTTTAAAGACAAGACCTGAATTCTACTGCTTCAGTTAGTCT
TAAGTTACTTGTGTCAAATATAATCCATTTTAAGAAAATCTCGTACTTGGTGGACTTTAT
AATGGCTAAATAGTTTTATGGGATTTAAGAGCTAAGAGTACACCTATACAGAGAACTACA
TTCACAACTGGTCATTCTTATCCTATATACTCTTTAGATGTAGTCGGTTCTGTAAATGCA
CATAATATTATTTCTATTTCAAATGATGGTAAACTTTGCGTTTGGAATATGAACATGCTT
ACTTAGCCTTCTAAAACTATTGACTAATTAACTTATACTCCTCCTGAGAAAACAAAATAG
GATATAAATGTTACTTGTATGCAATTTCCTTAAGGAGATGCTAATAATTTTTACATAGGT
TCTGAAGATGGTTCATTCTATAGAACCTAGTTACACTCTAAGACTCAAAGCATGGTAGCA
GCTGTTCATGCTCATGATGCACCTATCTCTTCATTGAGCATTAGTCATGATCCAACTGGC
TCTCATTAACTTTCTGGTATGGTTTTAACTTCATCTTTTGATTGGACAGTAAAATTATGG
AATCCTAAAGTCAGTGGAAAACCTAAAAAAGTACTTACATTTGATTGCTCTGAAGATTAT
GTCTATGATGTTGCCTGGAATCCTGTTAATCCTTCACTATTTTGTTGTGTTGATGGCGAA
GGATACTTAGATGTCTGGGATTTATGTGAAGATATCGAAAATCCAGTTTACCATGAATAA
GAAGATAAATTTGCTCTAAACAAGTGCAGATGGAGTTTAGATGGTTCAAAGGTAGCAACA
GGTGACTCAAGAGGCAATCTTAGCATTTATAATTTGGATAAAAAATACCTAAAAATAAAT
GAAAATAAATTAAGCAATATAATTGATTTATATGAAAATAAATAATGA


>TTHERM_00773750(gene)
ATGAGCAAAAATATTGAAGACTACAAAAAAAAGCTTGAGGAGTAAACATATTTTTTAGAT
TTTCTAAATGTTATTTAGGTTTAGTTATTTTATGAGAATATGTGAGGGAAATAGGCTTAG
ATATAATTTGAAATAAATAAATGCAAAAATTAAAATTAGAAATAGTATCTTAAAATTAAA
TTATTTTTGTATAATAGATTAAAAAAAGGTAGAGCAGCTGCTAGAACAACTGAATAAATA
GTAGGAAATGTTTAGACTAGCTAGTAACCTGTTTAAAATATAGATAAAGAAGAATAAAAG
GAAAGCTAGTAAACAAGTTAGAGTCATTTAGATAATATTTCTAATTAACATTAAGAAGCA
AGTAGCTCATCCTAAAAGAAACTTAGGACTTTCAATTTAGAAATGGATAAATAAGTTATA
GAAATTAGCATTCCTCCTAAAGTATTTCCTATTTTGACTTAAAACAAGAATACATTATTC
AAATTTAATATTTCTTCCTTAAATCATATGATAGGAAAAAATTCATTATGAAAGAGAAAT
TTAATGCGATTTAGAAGTAGAACAACAAACTCATAAACTTTTCCATGGAACTGGAAATGA
ATCAGAAAGCAATTTCCAACATGTTTAAGTGGAAATTGAAAACCCCGATGTATTCTAAAA
TCCTCATCAAGTTTCTTCTTAAATAGCTGCCTCAGCTCATAAAGCATTACAATAACCTGT
CCTACCTTCTAAAGGTATTACAAAAATATAATTAGACTCAATAAATTATCTGAAAATATT
TTGATGTGTAAATATAAAAAGTTGAATTAACAGGAGAAGACATAAGTCATATTGTAAAAT
CTAAAAATTTCCTAGATTTTTTTAATAGAAGTTCTAGATTAATAGAAAAAGTAAATTTTT
AATAAAAATATATTTTAAATCAATAAAAAATTTATTTATAAATTAATTAATTAATAATTA
ATTTAAATTTGGAGCTAAAATTTATATAAATTAACATAGGCAATTACTAACAAAGACGAC
AGCAATCTCTATGCTTTAATTGATGTTATTGGAGATAAAAGCAATTCAAATTTACAATAG
TAAAATTTAATTTAAAAAACAAGCATTTTACTTACAATTAAACATTTTTAAAGAACAGGT
ATCAAAAGTTATTTATAACACTCAGTCAAACTTACTGATCAGTAATATGGTACCAACAGA
GTAGTTACTGGTATTGAGTGGTCTCCTCATGTAATTTCATTACATTTTAATTTTTTTTTC
TAACTTAAATAATAAATTTTTTAATGAATTTTTATTATTTTAGAGAAATGATTTAGTTCT
AGCTTCTTATTCCCAAAATGAATAAGGAAATATAAATGATCCTGTTGGGTTAGTTGCTTT
GTGGTCTTTATCTTTAAAGACAAGACCTGAATTCTACTGCTTCAGTTAGGTATAAAAAAT
ACTACTATCTATTTATTTTTTTAAAATAATTTTAAATAAAATTTAGTCTTAAGTTACTTG
TGTCAAATATAATCCATTTTAAGAAAATCTCGTACTTGGTGGACTTTATAATGGCTAAAT
AGTTTTATGGGATTTAAGAGCTAAGAGTACACCTATACAGAGAACTACATTCACAACTGG
TCATTCTTATCCTATATACTCTTTAGATGTAGTCGGTTCTGTAAATGCACATAATATTAT
TTCTATTTCAAATGATGGTAAACTTTGCGTTTGGAATATGAACATGCTTACTTAGCCTTC
TAAAACTATTGACTAATTAACTTATACTCCTCCTGAGAAAACAAAATAGGATATAAATGT
TACTTGTATGCAATTTCCTTAAGGAGATGCTAATAATTTTTACATAGGTTCTGAAGATGG
TTCATTCTATAGAACCTAGTTACACTCTAAGACGTAAATACTATTTTTCAACAATTTTTT
TTAATTTTATATTCAGATAAAATAATAGTCAAAGCATGGTAGCAGCTGTTCATGCTCATG
ATGCACCTATCTCTTCATTGAGCATTAGTCATGATCCAACTGGCTCTCATTAAGTAAATT
TCAAATATCTATAATAAATTTATTAAAATAAAATTTTTTTCTTTTCAAATTAAAGCTTTC
TGGTATGGTTTTAACTTCATCTTTTGATTGGACAGTAAAATTATGGAATCCTAAAGTCAG
TGGAAAACCTAAAAAAGTACTTACATTTGATTGCTCTGAAGATTATGTCTATGATGTTGC
CTGGAATCCTGTATTCATATTATAAATTTATTAATAAAAATATTTATATTATTCATTTAA
TTAGGTTAATCCTTCACTATTTTGTTGTGTTGATGGCGAAGGATACTTAGATGTCTGGGA
TTTATGTGAAGATATCGAAAATCCAGTTTACCATGAATAAGAAGGTATAATTAATTATAA
TATAAATTTACTTTATAAATATTATTTAAAATAGATAAATTTGCTCTAAACAAGTGCAGA
TGGAGTTTAGATGGTTCAAAGGTAGCAACAGGTGACTCAAGAGGCAATCTTAGCATTTAT
AATTTGGATAAAAAAGTAATTATTTATTTCATTATTCATTATTCATTTTAAATTATAAAA
ACACAATAATTAAAAACTTATTTTAAAAAATAGTACCTAAAAATAAATGAAAATAAATTA
AGCAATATAATTGATTTATATGAAAATAAATAATGA


>TTHERM_00773750(protein)
MSKNIEDYKKKLEELKKGRAAARTTEQIVGNVQTSQQPVQNIDKEEQKESQQTSQSHLDN
ISNQHQEASSSSQKKLRTFNLEMDKQVIEISIPPKEKIHYEREIQCDLEVEQQTHKLFHG
TGNESESNFQHVQVEIENPDVFQNPHQVSSQIAASAHKALQQPVLPSKVELTGEDISHIV
KSKNFLDFFNRSSRLIEKAITNKDDSNLYALIDVIGDKSNSNLQQTGIKSYLQHSVKLTD
QQYGTNRVVTGIEWSPHRNDLVLASYSQNEQGNINDPVGLVALWSLSLKTRPEFYCFSQS
QVTCVKYNPFQENLVLGGLYNGQIVLWDLRAKSTPIQRTTFTTGHSYPIYSLDVVGSVNA
HNIISISNDGKLCVWNMNMLTQPSKTIDQLTYTPPEKTKQDINVTCMQFPQGDANNFYIG
SEDGSFYRTQLHSKTQSMVAAVHAHDAPISSLSISHDPTGSHQLSGMVLTSSFDWTVKLW
NPKVSGKPKKVLTFDCSEDYVYDVAWNPVNPSLFCCVDGEGYLDVWDLCEDIENPVYHEQ
EDKFALNKCRWSLDGSKVATGDSRGNLSIYNLDKKYLKINENKLSNIIDLYENKQ