Identifiers and Description

Gene Model Identifier

TTHERM_00777270

Standard Name

CCP1 (Cytoplasmic Cytoskeletal Protein 1)

Aliases

PreTt21141 | 129.m00112

Description

hypothetical protein; Constitutively localized throughout cytoplasm. Hypothesized to act as a membrane cytoskeletal protein.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09508.1 2.0003615238957836e-139
Description: hypothetical protein (2107 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00777270(coding)
ATGTAAAAATAAGAACTTATAGTTACAATTAGACCTGCTTATAACCCTACCCATTATTTA
TTCCCTGCAAATGATGGTTCAAGGGCTTATAACTAAGACTTTGATGTTAGAACTCATGCT
AGTTAAGAGCAAAGAAACCAATTAATCCTTACTCGTGTCAAGGATAATGTCTTCACAATT
AAATCTGCTACTAATCCTACTCACTACATGTTTGCTTCTAATGATAGTCACAGATCTGAT
GGAAAAGATTTTGATGTCAGAACTCATGCTTCAGATGAAGAAAGAAATCAATGGATTATT
GAAGAATACGCCTAAGGATTCCATATTAGAGTTTATACCAATCCTACTCACTACTTATTC
CCTGCCAACGACGGTTCTAATGGCTTAGGAGCTGATTTTGATGTTAGAACTCATCCCCAC
AAGGAAGAAAGAAATCTTTGGTTTATTGATGGTCTTATCTATGCTCCTCCTACTTAAAAA
ACTACTCTTAGAGTTAAGGCTAATCCTAATCACTTCATGTTTGCCTCAAACGATGGTGTT
AGAGGATTAAATAAAGATTTTGATGTTAGAACTCATGCCAGCTCTGAAGAAAGAAATTTC
ATCTTAATCCATCATGTCGGTCATCACGTATATACTCTTGCCAGTGCTACTAATCCTAAT
CACTTTTTCTTCCCCTCTGATGATGGAACTAGAGCTTATGCCCACGATTTTGACGTCAGA
ACTCATACTTATCAAGAAGAAAGAAACAAATGGATTATTGAAAGTGATAATCAAGGAGGC
TTCTTCATTAGATCTTTTGTCAAACCCTAACACTACTTATTTGCTGCTAACGATGGTTCA
AATAGCTACGGTGGTGACTTCGATGTCAGAACTCATGCCAGCTAAGAAGCTAGAAACGCT
TGGATTATTGATGGTTTTGTTTTACATAACTACTGA


>TTHERM_00777270(gene)
ATGTAAAAATAAGAACTTATAGTTACAATTAGACCTGCTTATAACCCTACCCATTATTTA
TTCCCTGCAAATGATGGTTCAAGGGCTTATAACTAAGACTTTGATGTTAGAACTCATGCT
AGTTAAGAGCAAAGAAACCAATTAATCCTTACTCGTGTCAAGGATAATGTCTTCACAATT
AAATCTGCTACTAATCCTACTCACTACATGTTTGCTTCTAATGATAGTCACAGATCTGAT
GGAAAAGATTTTGATGTCAGAACTCATGCTTCAGATGAAGAAAGAAATCAATGGATTATT
GAAGAATACGCCTAAGGATTCCATATTAGAGTTTATACCAATCCTACTCACTACTTATTC
CCTGCCAACGACGGTTCTAATGGCTTAGGAGCTGATTTTGATGTTAGAACTCATCCCCAC
AAGGAAGAAAGAAATCTTTGGTTTATTGATGGTCTTATCTATGCTCCTCCTACTTAAAAA
ACTACTCTTAGAGTTAAGGCTAATCCTAATCACTTCATGTTTGCCTCAAACGATGGTGTT
AGAGGATTAAATAAAGATTTTGATGTTAGAACTCATGCCAGCTCTGAAGAAAGAAATTTC
ATCTTAATCCATCATGTCGGTCATCACGTATATACTCTTGCCAGTGCTACTAATCCTAAT
CACTTTTTCTTCCCCTCTGATGATGGAACTAGAGCTTATGCCCACGATTTTGACGTCAGA
ACTCATACTTATCAAGAAGAAAGAAACAAATGGATTATTGAAAGTGATAATCAAGGAGGC
TTCTTCATTAGATCTTTTGTCAAACCCTAACACTACTTATTTGCTGCTAACGATGGTTCA
AATAGCTACGGTGGTGACTTCGATGTCAGAACTCATGCCAGCTAAGAAGCTAGAAACGCT
TGGATTATTGATGGTTTTGTTTTACATAACTACTGA


>TTHERM_00777270(protein)
MQKQELIVTIRPAYNPTHYLFPANDGSRAYNQDFDVRTHASQEQRNQLILTRVKDNVFTI
KSATNPTHYMFASNDSHRSDGKDFDVRTHASDEERNQWIIEEYAQGFHIRVYTNPTHYLF
PANDGSNGLGADFDVRTHPHKEERNLWFIDGLIYAPPTQKTTLRVKANPNHFMFASNDGV
RGLNKDFDVRTHASSEERNFILIHHVGHHVYTLASATNPNHFFFPSDDGTRAYAHDFDVR
THTYQEERNKWIIESDNQGGFFIRSFVKPQHYLFAANDGSNSYGGDFDVRTHASQEARNA
WIIDGFVLHNY