Identifiers and Description

Gene Model Identifier

TTHERM_00780580

Standard Name

CYC16 (CYClin 16)

Aliases

PreTt01270 | 130.m00080 | 3738.m00016

Description

CYC16 amine-terminal domain cyclin; Cyclin; N-terminal domain containing protein; regulates activity of cyclin-dependent kinases; expressed during conjugation

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18655.1 9.997093137033517e-262
Description: cyclin domain-containing protein (257 aa)
Oxytricha Contig22365.0.g49 3.999582750711782e-108
Description: Cyclin
Stentor Coeruleus SteCoe_32408 1.1379798735078682e-50
Description: None
DictyBase DDB_G0277667 7.000028900755185e-46
Description: DDB_G0277667 on chromosome: 2 position 8286817 to 8288311
WormBase WBGene00022697 1.0004783691736523e-35
Description: locus:cyy-1 Uncharacterized cyclin-like protein ZK353.1 status:Partially_confirmed UniProt:P34624 protein_id:CCD73200.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00780580(coding)
ATGCAAAAAGCTCCATAATAGCAAAAGTTTAGTACTTCAAATACTTTGTTTATCCGTCAT
ACGATTTCATCTCCAAATGTGAAATCTATTATTTAGGCAGTAGCTACTATTCTTCACTCT
TAAATGCACGAAGATTTCTAATCAGGAAAAGAAGTTCCTAAAGGTTCTGACCTTCATTTC
TTCTCTGAAGAAAAATATATTGAAGAAAAACCAGAAGAGTTCGATGAAGCTCGTCGTGCC
TTGCTTCGTGAAACTCCATCTGTAGATAACATTTATGAATTTATGAAAGCTCTTTATGAA
TGTGCCAAATTCTCTCCTGAATGCTGCATTATCTGTTTAGTTTACATTAATAGATTGATT
GCATTCACAGGTTTGCCTCTTTATCCAACAAACTGGCGTCCTCTTATCCTTTGCTCTTTA
TTAGTAGCACAAAAAGTATGGGATGACAAGTACTTATCAAATGCTGACTTTGCTTTCATC
TATCCTTTCTTCGTTACTGAAGAAATCAATGCTTTAGAACAAAAGTTCCTTGAATTACTC
TAATACAATGTCACTGTAAAAAGTGCTCTTTATGCTAAATACTACTTTGAATTAAGAGCC
CTCTTTAAAAACGAATCTGAATTCCCCTTAACCCCTCTTGATGTTGATCAAGAAAAGGAA
CTCGAATCAAGATCTTAATAAATGTAAAACAAAGAAAAAGAAAAAGCATAAAAGAATTCT
CTCACTTATAACGAGAAGCAAACCAAAAGACCTAATGCCTCTCTTAATGTATGA


>TTHERM_00780580(gene)
ATGCAAAAAGCTCCATAATAGCAAAAGTTTAGTACTTCAAATACTTTGTTTATCCGTCAT
ACGATTTCATCTCCAAATGTGAAATCTATTATTTAGGCAGTAGCTACTATTCTTCACTCT
TAAATGCACGAAGATTTCTAATCAGGAAAAGAAGTTCCTAAAGGTTCTGACCTTCATTTC
TTCTCTGAAGAAAAATATATTGAAGAAAAACCAGAAGAGTTCGATGAAGCTCGTCGTGCC
TTGCTTCGTGAAACTCCATCTGTAGATAACATTTATGAATTTATGAAAGCTCTTTATGAA
TGTGCCAAATTCTCTCCTGAATGCTGCATTATCTGTTTAGTTTACATTAATAGATTGATT
GCATTCACAGGTTTGCCTCTTTATCCAACAAACTGGCGTCCTCTTATCCTTTGCTCTTTA
TTAGTAGCACAAAAAGTATGGGATGACAAGTACTTATCAAATGCTGACTTTGCTTTCATC
TATCCTTTCTTCGTTACTGAAGAAATCAATGCTTTAGAACAAAAGTTCCTTGAATTACTC
TAATACAATGTCACTGTAAAAAGTGCTCTTTATGCTAAATACTACTTTGAATTAAGAGCC
CTCTTTAAAAACGAATCTGAATTCCCCTTAACCCCTCTTGATGTTGATCAAGAAAAGGAA
CTCGAATCAAGATCTTAATAAATGTAAAACAAAGAAAAAGAAAAAGCATAAAAGAATTCT
CTCACTTATAACGAGAAGCAAACCAAAAGACCTAATGCCTCTCTTAATGTATGA


>TTHERM_00780580(protein)
MQKAPQQQKFSTSNTLFIRHTISSPNVKSIIQAVATILHSQMHEDFQSGKEVPKGSDLHF
FSEEKYIEEKPEEFDEARRALLRETPSVDNIYEFMKALYECAKFSPECCIICLVYINRLI
AFTGLPLYPTNWRPLILCSLLVAQKVWDDKYLSNADFAFIYPFFVTEEINALEQKFLELL
QYNVTVKSALYAKYYFELRALFKNESEFPLTPLDVDQEKELESRSQQMQNKEKEKAQKNS
LTYNEKQTKRPNASLNV