Identifiers and Description

Gene Model Identifier

TTHERM_00780960

Standard Name

RPL27 (Ribosomal Protein of the Large subunit #27)

Aliases

PreTt01308 | 130.m00118 | 3738.m00054

Description

RPL27 60S ribosomal protein L27; Homolog of Yeast RPL27- Human RPL27; Alias RPL27e

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18688.1 5.998946283774988e-95
Description: hypothetical protein (175 aa)
Oxytricha Contig10169.0.g99 9.996696112986116e-50
Description: Ribosomal L27e protein family
SGD YDR471W 4.997755005759707e-41
Description: RPL27B Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl27Ap and has similarity to rat L27 ribosomal protein
WormBase WBGene00004441 8.997017754360629e-34
Description: locus:rpl-27 60S ribosomal protein L27 status:Confirmed UniProt:P91914 protein_id:CCD67946.1
DictyBase DDB_G0271298 9.99723014177113e-33
Description: rpl27 on chromosome: 2 position 140424 to 141268
Stentor Coeruleus SteCoe_35652 1.5628821893349888e-18
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00780960(coding)
ATGGCCAAATTCCTCAAGTACGGTAGAGTTGTCATCCTTTTACAAGGTAGATTCGCTGGT
AAGAAGGCTGTCATCGTCAAGTCCTCTGAAGATGGTACCAAGGACAGAAAGTTCGGTCAC
GTCTTAGTTGCTGGTGTTGAAAGATCCCCCAAGAAGGTCACCAAGAGAATGGGTTCCAAG
AAGATCTAAAAGAGAACTTCCGTCAAGCCCTTCATTAAATACGTCAACCTTAACCATATC
ATGCCCACCAGATACTCCGTTAAGGAACTCTGTGACTTCAAGGAACTTGTTAAGGAAGAT
AAGATCAAGAACAACGCTAAGTCTGAAGTTAGAGACACCTTAAAGAAGGTCTTCGTCGAA
AAGTACAGAACCATCAACCCCGAAGAAAAGAGCGCTTCTCACACTAAATTCTTCTTCTCC
AAGCTTAGATTCTGA


>TTHERM_00780960(gene)
ATGGCCAAATTGTAATAAATATTATTCAGTAGATGTCTTTTTGATTTACAATATTTTTAT
TAATTAATATAGCCTCAAGTACGGTAGAGTTGTCATCCTTTTACAAGGTAGATTCGCTGG
TAAGAAGGCTGTCATCGTCAAGTCCTCTGAAGATGGTACCAAGGTATGTATTTAAAGATT
CTACAATTTCAGAAACTTAGATTATTACAAATGATGTTTTAAAGAAATTAAATTTGCTCC
TCTTTAATTAAGACAAATTAAGCAAATAAGCGAATTTTTGAAAGAAAAAAAAAACTACTT
TTATGGAATTTTCATTAAGTTAATTTTAAAATTGGCATCCAAAAATTTATTTGCTTTCAT
TTTCAGACAATGAAAAGTATCTTTTAGCCTTTCACTTTTAAGGCTGATATTATCAAATTT
ACTGAGGAACAAAAATGTGTTTATCAATAAATTGATCTAATATTCAAAATTTAATCAACA
GGACAGAAAGTTCGGTCACGTCTTAGTTGCTGGTGTTGAAAGATCCCCCAAGAAGGTCAC
CAAGAGAATGGGTTCCAAGAAGATCTAAAAGAGAACTTCCGTCAAGCCCTTCATTAAATA
CGTCAACCTTAACCATATCATGCCCACCAGGTAATTAATTAATTATCTATATTAAGAAAA
GATGGATTACAGATTAGACATTCTTTTAGCTAAATTTAGTAATACAGTTATTAGAGGGTA
AATAAATAAGATAGGAGAATTGAAAATTATTAACTGCAATATGGGTAAAGTAAGATATGT
GAAAAAGGAATAAAAAAGATTGTGAAAACTACCTAAAATAAATATATAACTAAAAGAAGA
AGCATTTGTGTTAATTAGGCTTGAACAAAATAAATATTAGTAAATTAAAATGAATATAAT
ATATAAAGTAGAAAGCCTTAATTAAGTAGGACCACTAAAATTAATTACAGATATATATTG
CATGAACTTAGGGGTTTAAATAAATCTTTCTTTTGAATTCATTAAAATGAATTAAAACTG
ACAGGATTTCATTTAGTAGATAAATCTAAAATGACAGAGTCTCAATCAAAATAATAAAAT
TTATCTATTGTTTCAAGTTAAATTAAGAACTTTTAGAGTAGAAGTTCATATAAAAAAATA
AATTAGTGGAAGATTAGCGATAATGTTAATATAAATTTACTTACTTACCTACCTACCTTC
AATCTATCCTATTGGCAATTTAAGATAATTAATTAACTAACCCTTAATAATTATGAGCTG
GAGATCTATAAAATTTTCAGATACTTATTAAGCTAATAAGACAGACTAATTACTGAAAAA
TAAGTTTTTAACGTATTACAAGTTTTAAAGCTAAGAATAGAATTTTTTGAATCCATCATA
TATTTATTTATCATTGATTATGTTGAAGAAATCTTTTATTAAAAAATTTAAATTATTAAA
ATTTAGATACTCCGTTAAGGAACTCTGTGACTTCAAGGAACTTGTTAAGGAAGATAAGAT
CAAGAACAACGCTAAGTCTGAAGTTAGAGACACCTTAAAGAAGGTCTTCGTCGAAAAGTA
CAGAACCATCAACCCCGAAGAAAAGAGCGCTTCTCACACTAAATTCTTCTTCTCCAAGCT
TAGATTCTGA


>TTHERM_00780960(protein)
MAKFLKYGRVVILLQGRFAGKKAVIVKSSEDGTKDRKFGHVLVAGVERSPKKVTKRMGSK
KIQKRTSVKPFIKYVNLNHIMPTRYSVKELCDFKELVKEDKIKNNAKSEVRDTLKKVFVE
KYRTINPEEKSASHTKFFFSKLRF