Identifiers and Description

Gene Model Identifier

TTHERM_00782060

Standard Name

TCT1B

Aliases

PreTt25508 | 131.m00081 | 3813.m01583 | Tctex1B

Description

TCT1B dynein light chain tctex-type 1 protein; Light chain subunit of ciliary three-headed outer arm dynein (OAD)- two-headed inner arm dynein (IAD) complex 1- and non-axonemal dynein complex 1

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11407.1 3.0008725323024365e-87
Description: tctex-1 family protein (124 aa)
Oxytricha Contig7426.0.g14 3.999970367130025e-21
Description: Tctex-1 family
DictyBase DDB_G0284589 0.000000000000020000882446601127
Description: dlcA on chromosome: 4 position 2178851 to 2179736
WormBase WBGene00008764 0.0000029996948234116693
Description: locus:dylt-1 status:Confirmed UniProt:Q19416 protein_id:CAA95796.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00782060(coding)
ATGGCTGAGGATAATATTGATGAACAAACATTTTAGCAGGACGAAACAGAAAAGCAAGTA
GTTACCTATATAGAAAAAGTTTTGTAAGGAAAAGATTATAAAGAAGATATGGTTCCTCAA
TGGATTAACGAAATATGCGAATAAACATTAGAATACTTAATAAAGCAGTAAAAACCCTAT
AAATATATGGTAAATTGTATGATAATGCAAAGTACGGGTACGGGAGCGTGCGCTGCGTAG
AGTTGCTTTTGGGATGGTGTTGTAGATGGTATCGCAATAATTAAATGGCCTAAGGATAGC
AAAGAATATTCAAAAAATTAAGTTAGTGCAATAGTTACAGTATTTGCATCATCATTAGTT
CCTAATCATTGA


>TTHERM_00782060(gene)
ATGGCTGAGGATAATATTGATGAACAAACATTTTAGCAGGACGAAACAGAAAAGCAAGTA
GTTACCTATATAGAAAAAGTTTTGTAAGGAAAAGATTATAAAGAAGATATGGTTCCTCAA
TGGATTAACGAAATATGCGAATAAACATTAGAATACTTAATAAAGCAGTAAAAACCCTAT
AAATATATGGTAAATTGTATGATAATGCAAAGTACGGGTACGGGAGCGTGCGCTGCGTAG
AGTTGCTTTTGGGATGGTGTTGTAGATGGTATCGCAATAATTAAATGGCCTAAGGATAGC
AAAGAATATTCAAAAAATTAAGTTAGTGCAATAGTTACAGTATTTGCATCATCATTAGTT
CCTAATCATTGA


>TTHERM_00782060(protein)
MAEDNIDEQTFQQDETEKQVVTYIEKVLQGKDYKEDMVPQWINEICEQTLEYLIKQQKPY
KYMVNCMIMQSTGTGACAAQSCFWDGVVDGIAIIKWPKDSKEYSKNQVSAIVTVFASSLV
PNH