Identifiers and Description

Gene Model Identifier

TTHERM_00784600

Standard Name

KET2 (Fusion of a kinesin and an ER-golgi vesicle tethering protein )

Aliases

PreTt25564 | 131.m00137 | 3813.m01641

Description

KET2 kinesin motor catalytic domain protein; Fusion of a kinesin and an ER-golgi vesicle tethering protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11436.1 9.997093137033517e-262
Description: kinesin motor domain-containing protein (1251 aa)
SGD YGL216W 3.999970367130025e-21
Description: KIP3 Kinesin-related motor protein involved in mitotic spindle positioning
WormBase WBGene00003884 9.997019043202629e-21
Description: locus:osm-3 Osmotic avoidance abnormal protein 3 status:Confirmed UniProt:P46873 protein_id:CCD70203.1
Oxytricha Contig781.1.g64 3.9992896861436003e-19
Description: Kinesin motor domain
DictyBase DDB_G0293198 2.9992476920535046e-16
Description: kif10 on chromosome: 6 position 2654607 to 2658323
Stentor Coeruleus SteCoe_34867 0.00000000003775134544279098
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00784600(coding)
ATGAAGAGAGTTCAATCTTAAGAGTAGCTTGGTTAAGAAAAAAGAGGAGGAGTTTAAGTG
TTTGTTAGGGTAAAACCCACATAAGATGGTGACCAAAGCATATTTTCAGGAGATGATGAA
AATGGTAGATCAGTTGTTGCCACTAAAACCCCTCAAAGATCAAGATAAATATAATATAGC
TACAAAAATGATAGAAGTTTAGAAAAGTTAAATGAAATATTTTAAGATAAGGCTGATGTT
TTCTTTTTTGATAATGTGTTTAGCCAAAAATCCAGCTAAGAAATCTTCTATCGCAAGACA
GCTAAAGAAGCAGTTTCAAACGTTGTTAGTGGATAAAACACTTCCATTTTGATACATGGT
CCATCAAGATGCGGAAAAACATATACTCTCACTGGTGCAGATAAACACTAAAAAGGATTG
ATGTTTAGATGTGTAGATGATCTTTTATCCAAAATAGATGTTGCCAATGAATAGGATTCC
TAATACAAATTATTCTTGTCTATTTTCTCAGTATACAATAATGAGATATTTGATCTTCTC
AGTAATGAGAATTCTGATTATTATGAAGTAATTGAGTATAGTCCAAATGATGTTAGAATT
GCAGGTATGTCAAGACATTTAATCAAATACAAGAGCGAATTTAAGAATAAATACGTGAAT
GCATTAAAGAAAATATAGTCTCTTAGCTAGCTTTTGAATGAAAAAAAGCTTTATGAAAAA
AGTCATATTGTTGTCCAGTTCAATGTTTCTGAAAGTGAATAAATAAATTTCAAACTCAAT
TTAGTAAGACTTGCAGATATTGATTTAGTAGATAAATAAATAAATGGAGATGATTTTGAG
GTTATCGAGCAATACATTAATTAAATCAATTAAAACACTTCATATTAAACTAGAGCTTAT
AAAAAGTGTAAATTAACTTCATGCATTAGAGATACAATTAATGAAAATACTCAATCTTTC
TTTATATCATGCGTTTCTTCATCATCTAATTAGTATGCTTAATCTCTTCTCTCATTAGAC
TATACATAAAGACTTTGTGCTTAGGGCTCACGCCTTCATGATGGAAATGAAATTAGAAGT
AGTTTTACTAGCAATTCTTAAAAAAGACTCCTTCCTAGCAGACCTCCTGTTTCACCAAAT
TCTGTAAAATCAAGCTTGATTGAAAACACTTTGAGACCTCAGCTCTCTTAATCAAATTTA
AGATAAAGCAATATTATTAATCAAAGTAGCACAGCTCCTAAATCAAATATTTAGAATTCT
CACATTGAGTTTATTGTTAATGAGTTGGAAAATATTTTTGAGGATATTCGTAAGCAATCA
CGTGTATTTGGAAGACTACCTGAAAGAGAAAGAAACGAATGGGTTAGCTAAAAAGAAATC
ATTTTAAACGATCTTTAGAGATAGATTGAGTTACAGCCCTACAGCAGAGATATTCCTTAT
TGCGAGACTCTTCTAACCAAGTGCTAAAGATAGTTAAGACTTATTAATCCTAGCTTAAGC
GATTAAAGATAAATTAGTGGTTCTCCTCCTTAAGGACATGTGAATAATTTAGGGCAAGGA
AAGCTAAATGGCTCATAAACAAATTTCTTTTAAGGAAATTTAAATAATAGCTTTTCTAGA
GTTAACCAACACAATAGAAGATAAAGTTAAGGAGGATATGCTGAAAAAGTAGGTCGCCTT
TCTCCTTCTCAAGAAAACAGATATAATGATTATGAGTTTTTAAAAGATAAAGAAGAAAAA
TTAGACAAAGACTTCATGCGCCTTCTTGATAGATATAATCACTCTAAGGAGCTGATTGAT
AGTCTCAGCAATCCTTAAGGATAATAATAGCACTCTCAATTAAATCAACCCTATCCATAG
TAATTGTAAAGAGTTTAGACTCAACCTTCTCTAGGATAACGCTCTCCTATTTAAAGTATT
ATCAGAAACAGCTAAATCCTCTAATCGCCTCAATAGAGATTAGCTGATATAAGCAATGTT
CATCAATAACTCTAAAATAATCAAGAAATGTATCGTACTCAAGATTCATCAGGATTTTTA
GACCAACCTCCTATCAATAAATCCAAGGTTGCAGTTTCTAGCAATATTGGAGAACTCAGT
CCTAATTTTGACTTACTTAATGCAGAAGAAAAAGAGAAAAATGTAGGAAAAAGCTTAAAA
AGACTAAAAGAAACAATTGAAATCAAAGAAAATATAGAAAAATCAAAAATATAAAAACTC
TAACTACTTAATAAAGACTTAAAACAAAGTTTAAGGGAATATGTCGAAAAATACGAGTAG
CTTTCTGATATTCTAAACAGCAAAGATGGTGAAATCGATAGATTGTAGTATGAGCTTAGG
TAAGCTTAAGAGGACATTCTTCTTAATGTTGATACAGTTAAAGAATTCAAAATAAAGGAA
TAAGGATGGCTACAGATGGAAGAGGAGCTCAGAGAATCAAATATACAATTAAAATCGAAG
CTACTCAAGAAGAAGAAGAAAGTCAATTAAATAAAGGAGGAATTTAGAAGAAAAGAAGAA
GAGCTTGCATTTTAGAAAAAATCACATGACCACGAAATAGAAAAGTACTAAAGAACTGTT
TAAGAGCATGAAGAAATCAAGTCAGTAGACCAAAACAAGGCAACTGCTCTTTCAGAAATA
GTTAATTAATTAAAAAATGACATGGATTAGAGAGAATAAGAATAAAAACAAGTCTTCTAA
AACTTACAGGAAATGAGATAGTTGAACTAAGAGCTCAACTAAAAATATCAAAATGAAGTT
ATTGAGAAGAATGAAACAGTAAATTAGAATCATGCTTTAACAAGAAAGAAAGAGGAGCTT
GAAGAACAAGTGCAAATTCTTGAATAAAAAATTTAAAAGCACAAATAAAAATTTGAAGAT
GAAAAATCCAAGCTAATGGAGGAGAGAAACTAAGAAAACTTGAAGAAAAAAGAAAAGATA
AAGTTTTTAAAAGCTTAATTAGCTGATAACGAGGACAAACACCAAGAAATTGAAGGTAAA
TACTAGCTTCTAATAAAGCAAGCTGACAACTTGGAAGCCTAGTTAAGAGAAACTTAAAAG
TACCTTAATGAATTAAAAGAAATAAAAGACGAATAAACTTATAAGATAGCCAAATTGACT
GAAGAGAAAAATAACTCTTATTTGGAGAATGAAAGATTATAAAATTTAGTTACCTCTTTA
GAGGGTAGGGTAGAAAAATTGGAGGCATCACAGTTGGGAGATGCTAAAACTATCAACGAG
CTAAAAGAACAAAGCAGCCGTTTGCAATCTGAGCTTAATGAAAAAGAAGATCAATTATAA
AAGGCTAACTAACACATTGATTAGTTACAAGAATAGTAAAACATCGAACTTAGCACTTTT
GAAATAAGATTAGACCAAGTTGTTCAGGAATTCACAGCCTGCAAGGAAGAAAACAATGAA
TTTAAGAGAAAGGAAATTGACAACAAGAAACTCCTTCAAAACTTAGAAGAATAAGTTGAA
AAGTATAAAGAAAAATACTTAAAGGCTAAACACTCAAATAAAAATCTACAATCTCATTTA
AAAGAACTAGAAAATCGTGTAAAAGATTACATGACTGAAAGATCTATAGAAGTTTAAGCC
TAAGCTCGTGAACGTGAAAGACAAACTAAAGTTGAATAAACTCAAAAGAATAAATTAAGA
ATTCTTGATGAAATTTAACAAATGATTAAAAGTCATAAACACAATTCCACAGTATAAAAA
TATGAAAATTGA


>TTHERM_00784600(gene)
ATGAAGAGAGTTCAATCTTAAGAGTAGCTTGGTTAAGGTAATTCACTGACTCAAAATTCT
TAAAATTTATTAGGCAGTGCTAAATTAAATATTTATGAAAAAGCAGAAAAAAGAGGAGGA
GTTTAAGTGTTTGTTAGGGTAAAACCCACATAAGATGGTGACCAAAGCATATTTTCAGGA
GATGATGAAAATGGTAGATCAGTTGTTGCCACTAAAACCCCTCAAAGATCAAGATAAATA
TAATATAGCTACAAAAATGATAGAAGTTTAGAAAAGTTAAATGAAATATTTTAAGATAAG
GCTGATGTTTTCTTTTTTGATAATGTGTTTAGCCAAAAATCCAGGTAAATTTGCAACGTT
AAATTGATCAGATTAACAAAGCAAGATAAGCGATGAAATTTATATTATTATGAAACTTTT
TTCATTACTATAAAGATAAATAGTTTCATATCTAAATTTCTATTTTATCAAATAAAGCTA
AGAAATCTTCTATCGCAAGACAGCTAAAGAAGCAGTTTCAAACGTTGTTAGTGGATAAAA
CACTTCCATTTTGATACATGGTCCATCAAGGTAGATTATTTAAAATATATGAGCCAGCAT
TTTTAAAATAAAAGCATAAAATAACAAAAAATAAAAATAGTCTTAGCTTTTTCATTTGCT
AAAATACTTTTTATTTCTATATAAAGATGCGGAAAAACATATACTCTCACTGGTGCAGAT
AAACACTAAAAAGGATTGATGTTTAGATGTGTAGATGATCTTTTATCCAAAATAGATGTT
GCCAATGAATAGGATTCCTAATACAAATTATTCTTGTCTATTTTCTCAGTATACAATAAT
GAGATATTTGATCTTCTCAGTAATGAGAATTCTGATTATTATGTAAAAAAAAACTTGGCA
ATTTACAAAATTTAGGCAATACTTAATTGTCTCTTTATGTCTCAATAAAATTTTAAATAA
TATTAAGACTATTTCAAACAATATTTTAATTGCTGTAAAATTTAAATTTTAAAAGGAAGT
AATTGAGTATAGTCCAAATGATGTTAGAATTGCAGGTATGTCAAGACATTTAATCAAATA
CAAGAGCGAATTTAAGAATAAATACGTGAATGCATTAAAGAAAATATAGTCTCTTAGCTA
GCTTTTGAATGAAAAAAAGCTTTATGAAAAAAGTCATATTGTTGTCCAGTTCAATGTTTC
TGAAAGTGAATAAATAAATTTCAAACTCAATTTAGTAAGACTTGCAGATATTGATTTAGT
AGATAAATAAATAAATGGAGATGATTTTGAGGTTATCGAGCAATACATTAATTAAATCAA
TTAAAACACTTCATATTAAACTAGAGCTTATAAAAAGTGTAAATTAACTTCATGCATTAG
AGATACAATTAATGAAAATACTCAATCTTTCTTTATATCATGCGTTTCTTCATCATCTAA
TTAGTATGCTTAATCTCTTCTCTCATTAGACGTAAGCATTTCTTTCGTTTTTTAATAAGC
AATGAAATTATTTTTAAAGAACTAAAACCTTTTAAAATTATTATCAATATTCATTAAGCA
AAAATTAATTTAAATTTAATAAAAACTAAGAAAAACAAATTAATTTTTTGTTATTATTTT
TGATTTTAAATTAATTTTTGTTATTATTTTTGATTTTAAATAAATAATTTTTAAACAGTA
TACATAAAGACTTTGTGCTTAGGGCTCACGCCTTCATGATGGAAATGAAATTAGAAGTAG
TTTTACTAGCAATTCTTAAAAAAGACTCCTTCCTAGCAGACCTCCTGTTTCACCAAATTC
TGTAAAATCAAGCTTGATTGAAAACACTTTGAGACCTCAGCTCTCTTAATCAAATTTAAG
ATAAAGCAATATTATTAATCAAAGTAGCACAGCTCCTAAATCAAATATTTAGAATTCTCA
CATTGAGTTTATTGTTAATGAGTTGGAAAATATTTTTGAGGATATTCGTAAGCAATCACG
TGTATTTGGAAGACTACCTGAAAGAGAAAGAAACGAATGGGTTAGCTAAAAAGAAATCAT
TTTAAACGATCTTTAGAGATAGATTGAGTTACAGCCCTACAGCAGAGATGTAAGATTAAT
TATTTTAAAAAATAAATTAGAATATAATTAAAATTAAATGAGATTAAAGATTTTAAAATA
TAATTATTGAAACAGATTCCTTATTGCGAGACTCTTCTAACCAAGTGCTAAAGATAGTTA
AGACTTATTAATCCTAGCTTAAGCGATTAAAGATAAATTAGTGGTTCTCCTCCTTAAGGA
CATGTGAATAATTTAGGGCAAGGAAAGCTAAATGGCTCATAAACAAATTTCTTTTAAGGA
AATTTAAATAATAGCTTTTCTAGAGTTAACCAACACAATAGAAGATAAAGTTAAGGAGGA
TATGCTGAAAAAGTAGGTCGCCTTTCTCCTTCTCAAGAAAACAGATATAATGATTATGAG
TTTTTAAAAGATAAAGAAGAAAAATTAGACAAAGACTTCATGCGCCTTCTTGATAGATAT
AATCACTCTAAGGAGCTGATTGATAGTCTCAGCAATCCTTAAGGATAATAATAGCACTCT
CAATTAAATCAACCCTATCCATAGTAATTGTAAAGAGTTTAGACTCAACCTTCTCTAGGA
TAACGCTCTCCTATTTAAAGTATTATCAGAAACAGCTAAATCCTCTAATCGCCTCAATAG
AGATTAGCTGATATAAGCAATGTTCATCAATAACTCTAAAATAATCAAGAAATGTATCGT
ACTCAAGATTCATCAGGATTTTTAGACCAACCTCCTATCAATAAATCCAAGGTTGCAGTT
TCTAGCAATATTGGAGAACTCAGTCCTAATTTTGACTTACTTAATGCAGAAGAAAAAGAG
AAAAATGTAGGAAAAAGCTTAAAAAGACTAAAAGAAACAATTGAAATCAAAGAAAATATA
GAAAAATCAAAAATATAAAAACTCTAACTACTTAATAAAGACTTAAAACAAAGTTTAAGG
GAATATGTCGAAAAATACGAGTAGCTTTCTGATATTCTAAACAGCAAAGATGGTGAAATC
GATAGATTGTAGTATGAGCTTAGGTAAGCTTAAGAGGACATTCTTCTTAATGTTGATACA
GTTAAAGAATTCAAAATAAAGGAATAAGGATGGCTACAGATGGAAGAGGAGCTCAGAGAA
TCAAATATACAATTAAAATCGAAGCTACTCAAGAAGAAGAAGAAAGTCAATTAAATAAAG
TAATTACTAAGAAACAAATAAATATTTTATTTTAAAATAAATTATAATCCTGAATAAACA
AACTCACTCAAAATACTAAAAAAATAGGGAGGAATTTAGAAGAAAAGAAGAAGAGCTTGC
ATTTTAGAAAAAATCACATGACCACGAAATAGAAAAGTACTAAAGAACTGTTTAAGAGCA
TGAAGAAATCAAGTAAAATATTTTTTAGAAAATAGAAATAAAATATTAAAAATAAAATAT
ATTTATAAAAATAGGTCAGTAGACCAAAACAAGGCAACTGCTCTTTCAGAAATAGTTAAT
TAATTAAAAAATGACATGGATTAGAGAGAATAAGAATAAAAACAAGTCTTCTAAAACTTA
CAGGAAATGAGATAGTTGAACTAAGAGCTCAACTAAAAATATCAAAATGAAGTTATTGAG
AAGAATGAAACAGTAAATTAGAATCATGCTTTAACAAGAAAGAAAGAGGAGCTTGAAGAA
CAAGTGCAAATTCTTGAATAAAAAATTTAAAAGCACAAATAAAAATTTGAAGATGAAAAA
TCCAAGCTAATGGAGGAGAGAAACTAAGAAAACTTGAAGAAAAAAGAAAAGATAAAGTTT
TTAAAAGCTTAATTAGCTGATAACGAGGACAAACACCAAGAAATTGAAGGTAAATACTAG
CTTCTAATAAAGCAAGCTGACAACTTGGAAGCCTAGTTAAGAGAAACTTAAAAGTACCTT
AATGAATTAAAAGAAATAAAAGACGAATAAACTTATAAGATAGCCAAATTGACTGAAGAG
GTAAATATTTAGAAAAAAGAATCTAAATTTATATAAATAAAACCTATAAGTAAATAAAAT
GCAAAATATATTTTCCTGATGGAGCTTAAAAAGTTTTTGATTACTAAAAAATCGATTGAA
ATTTCTTTTATATGAACTTTTTATTAATTAAAAAAAAATATAGAAAAATAACTCTTATTT
GGAGAATGAAAGATTATAAAATTTAGTTACCTCTTTAGAGGGTAGGGTAGAAAAATTGGA
GGCATCACAGTTGGGAGATGCTAAAACTATCAACGAGGTATAAAAATAAAAGAAATATTA
ATGTAAAGAATTTAATTTTATTTCTTATATGATTTCTGATCATCAAAAGCTAAAAGAACA
AAGCAGCCGTTTGCAATCTGAGCTTAATGAAAAAGAAGATCAATTATAAAAGGCTAACTA
ACACATTGATTAGTTACAAGAATAGTAAAACATCGTAAATATTTTAAATTCAATTTATTA
TAATTTTTTATTAATTTTTTCTCATTAAACTTTTCTAAATATGAAAAAATGATATTAATT
ATTTTATTATTTAACATTTCCATTAAATTTAAATTTAACTTTTAATACTTTTATGTGTTA
TATTTAATAATATCAATTTATTTCTAAAAAAAAGGAACTTAGCACTTTTGAAATAAGATT
AGACCAAGTTGTTCAGGAATTCACAGCCTGCAAGGAAGAAAACAATGAATTTAAGAGAAA
GGAAATTGACAACAAGAAACTCCTTCAAAACTTAGAAGAATAAGTTGAAAAGTATAAAGA
AAAATACTTAAAGGCTAAACACTCAAATAAAAATCTACAATCTCATTTAAAAGAAGTAAA
AAATAAACAAGATTTAATTGAATTGCTTTTTAATCTTAATATTTTATTAATATAGCTAGA
AAATCGTGTAAAAGATTACATGACTGAAAGATCTATAGAAGTTTAAGCCTAAGCTCGTGA
ACGTGAAAGACAAACTAAAGTTGAATAAACTCAAAAGAATAAATTAAGAGTAAAATTTCA
CTAAACTCATTTTAAATTTAAATATTAAGCTTTATTCTTATTAAAATAGATTCTTGATGA
AATTTAACAAATGATTAAAAGTCATAAACACAATTCCACAGTATAAAAATATGAAAATTG
A


>TTHERM_00784600(protein)
MKRVQSQEQLGQEKRGGVQVFVRVKPTQDGDQSIFSGDDENGRSVVATKTPQRSRQIQYS
YKNDRSLEKLNEIFQDKADVFFFDNVFSQKSSQEIFYRKTAKEAVSNVVSGQNTSILIHG
PSRCGKTYTLTGADKHQKGLMFRCVDDLLSKIDVANEQDSQYKLFLSIFSVYNNEIFDLL
SNENSDYYEVIEYSPNDVRIAGMSRHLIKYKSEFKNKYVNALKKIQSLSQLLNEKKLYEK
SHIVVQFNVSESEQINFKLNLVRLADIDLVDKQINGDDFEVIEQYINQINQNTSYQTRAY
KKCKLTSCIRDTINENTQSFFISCVSSSSNQYAQSLLSLDYTQRLCAQGSRLHDGNEIRS
SFTSNSQKRLLPSRPPVSPNSVKSSLIENTLRPQLSQSNLRQSNIINQSSTAPKSNIQNS
HIEFIVNELENIFEDIRKQSRVFGRLPERERNEWVSQKEIILNDLQRQIELQPYSRDIPY
CETLLTKCQRQLRLINPSLSDQRQISGSPPQGHVNNLGQGKLNGSQTNFFQGNLNNSFSR
VNQHNRRQSQGGYAEKVGRLSPSQENRYNDYEFLKDKEEKLDKDFMRLLDRYNHSKELID
SLSNPQGQQQHSQLNQPYPQQLQRVQTQPSLGQRSPIQSIIRNSQILQSPQQRLADISNV
HQQLQNNQEMYRTQDSSGFLDQPPINKSKVAVSSNIGELSPNFDLLNAEEKEKNVGKSLK
RLKETIEIKENIEKSKIQKLQLLNKDLKQSLREYVEKYEQLSDILNSKDGEIDRLQYELR
QAQEDILLNVDTVKEFKIKEQGWLQMEEELRESNIQLKSKLLKKKKKVNQIKEEFRRKEE
ELAFQKKSHDHEIEKYQRTVQEHEEIKSVDQNKATALSEIVNQLKNDMDQREQEQKQVFQ
NLQEMRQLNQELNQKYQNEVIEKNETVNQNHALTRKKEELEEQVQILEQKIQKHKQKFED
EKSKLMEERNQENLKKKEKIKFLKAQLADNEDKHQEIEGKYQLLIKQADNLEAQLRETQK
YLNELKEIKDEQTYKIAKLTEEKNNSYLENERLQNLVTSLEGRVEKLEASQLGDAKTINE
LKEQSSRLQSELNEKEDQLQKANQHIDQLQEQQNIELSTFEIRLDQVVQEFTACKEENNE
FKRKEIDNKKLLQNLEEQVEKYKEKYLKAKHSNKNLQSHLKELENRVKDYMTERSIEVQA
QARERERQTKVEQTQKNKLRILDEIQQMIKSHKHNSTVQKYEN