Identifiers and Description

Gene Model Identifier

TTHERM_00794150

Standard Name

ADF73 (Actin-Depolymerizing Factor 73)

Aliases

PreTt21414 | 134.m00094

Description

ADF73 cofilin/tropomyosin-type actin-binding protein; Cofilin/tropomyosin-type actin binding protein; principle actin-modulating protein involved in membrane deformations (including phagocytosis- but not cytokinesis) by severing and depolymerizing F-actin.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00241 ) Cofilin/tropomyosin-type actin-binding protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13290.1 3.0013199058937152e-77
Description: cofilin/tropomyosin-type actin-binding protein (136 aa)
Oxytricha Contig8853.0.g81 1.999790113608142e-24
Description: Cofilin/tropomyosin-type actin-binding protein
SGD YLL050C 2.000620012690291e-23
Description: COF1 Cofilin, promotes actin filament depolarization in a pH-dependent manner; binds both actin monomers and filaments and severs filaments; thought to be regulated by phosphorylation at SER4; ubiquitous and essential in eukaryotes
DictyBase DDB_G0291970 4.997543945741262e-17
Description: cofB on chromosome: 6 position 1044327 to 1044740
WormBase WBGene00006794 0.00000000002000577768187062
Description: locus:unc-60 Actin-depolymerizing factor 2, isoform c status:Partially_confirmed UniProt:Q07749 protein_id:CCD67023.1
Stentor Coeruleus SteCoe_11359 0.000000002061153622438558
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23729382: Shiozaki N, Nakano K, Kushida Y, Noguchi TQ, Uyeda TQ, Wloga D, Dave D, Vasudevan KK, Gaertig J, Numata O (2013) ADF/cofilin is not essential but is critically important for actin activities during phagocytosis in Tetrahymena thermophila. Eukaryotic cell 12(8):1080-6
  2. Ref:19769938: Shiozaki N, Nakano K, Takaine M, Abe H, Numata O (2009) Usual and unusual biochemical properties of ADF/cofilin-like protein Adf73p in ciliate Tetrahymena thermophila. Biochemical and biophysical research communications 390(1):54-9
  3. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00794150(coding)
ATGGATATCGGCTTACAAGTTGCTGACGACTGTCTCTAATAATTCCAAGCCATGAAGATG
GAAAAGAAACATCGTTATATTATTTTTCACACTAAGAATAACAAGACCATTGAAATTGAA
AAGATTGGAGCTAGAGATGAAACCTACTAACAATTTGTTGACAGTCTCCCACAAAATGAT
GCTCGTTTCTGCGTTTTTGATTATGATAAGAAATTCGATGATGGCAGAGTCACCTCTAAG
ATTATCTATTTCTTCTGGTGTCCTGATACTGCCCCAGTCAAGGTCAAGATGGTCTCTGCT
ACTACCAATTCATTCTTCTAAAATAAAATCTAAGGTTTCGCTATCAACCTCTAATGCAAT
GATTTAGGTTCTTTCGATACCGAAGAACTCGAAAAGAAGATCCATTGA


>TTHERM_00794150(gene)
ATGGATATCGGCTTACAAGTTGCTGACGACTGTCTCTAATAATTCCAAGCCATGAAGATG
GAAAAGAAACATCGTTATATTATTTTTCACACTAAGAATAACAAGACCATTGAAATTGAA
AAGATTGGAGCTAGAGATGAAACCTACTAACAATTTGTTGACAGTCTCCCACAAAATGAT
GCTCGTTTCTGCGTTTTTGATTATGATAAGAAATTCGATGATGGCAGAGTCACCTCTAAG
ATTATCTATTTCTTCTGGTGTCCTGATACTGCCCCAGTCAAGGTCAAGATGGTCTCTGCT
ACTACCAATTCATTCTTCTAAAATAAAATCTAAGGTTTCGCTATCAACCTCTAATGCAAT
GATTTAGGTTCTTTCGATACCGAAGAACTCGAAAAGAAGATCCATTGA


>TTHERM_00794150(protein)
MDIGLQVADDCLQQFQAMKMEKKHRYIIFHTKNNKTIEIEKIGARDETYQQFVDSLPQND
ARFCVFDYDKKFDDGRVTSKIIYFFWCPDTAPVKVKMVSATTNSFFQNKIQGFAINLQCN
DLGSFDTEELEKKIH