Identifiers and Description

Gene Model Identifier

TTHERM_00794370

Standard Name

GST26 (Glutathione S-transferase mu 26, TtGSTm26, GSTm26)

Aliases

PreTt21436 | 134.m00116

Description

GST26 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13311.1 5.00077931415004e-148
Description: glutathione S-transferase domain-containing protein (250 aa)
Oxytricha Contig16299.0.g15 0.0000000000000700196834671948
Description: Glutathione S-transferase, N-terminal domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00794370(coding)
ATGTCTAAATAATCTTAAGAAAATTAACAAACTGATTTAGTGCTAGGCTATTGGCCATTT
GCAGGAAGAAATATGCCAGTTATTTTTATGCTGGAAATACTAAATATCCCTTATTAAGTT
AATATTTTTGACCAAAACACATGGTTTGGTAAAGAAAAAGAAGACCTCAATTTAGATTTC
CCAAATCTACCATTCCTTATTGATAACTCTAATGGTATGAAGATTACTGAAATACATAAC
ATCGTTAACTATATTCTCTATAAATATGAGAAAGGAAGAAATTTGTAGGACATTCATCGC
TCAAGTCCTTACACCTAAAGTCGCAATAGAGTTAAGTTGTCAGCTGATCATTCATCATAT
AATCCTATCGACGACTTCAAGATTGATGAAATCAGATTTATTTTAAACGATGTCTTCACT
CAAATATCTTCTGCTACTGCTAAGTTCCCCTAAGAAAACTAGATAAAATACGCTTAAGAT
ACCATAGTACCAAAATTGAATAAATTAATTAAATTTATAGAACAAAAAAATTAAGCTACT
ACATCATATACTCAATACTTTGTTATGGGGTATTTAAGTGTTGTAGACTGTTACTTCTAC
ATAATATCTAAGTACTTCTAGAAGTATTTCCCCTCACTTTATGATGATTACTCACATGTA
TTCGACTTGGTCCTTAATAGCTTTGAAAATATTCCTGAAATAAAAAAATACATCAATTCT
GATAAATATCCAACTCTAGGGTGA


>TTHERM_00794370(gene)
ATGTCTAAATAATCTTAAGAAAATTAACAAACTGATTTAGTGCTAGGCTATTGGCCATTT
GCAGGAAGAAATATGCCAGTTATTTTTATGCTGGAAATACTAAATATCCCTTATTAAGTT
AATATTTTTGACCAAAACACATGGTTTGGTAAAGAAAAAGAAGACCTCAATTTAGATTTC
CCAAATCTACCATTCCTTATTGATAACTCTAATGGTATGAAGATTACTGAAATACATAAC
ATCGTTAACTATATTCTCTATAAATATGAGAAAGGAAGAAATTTGTAGGACATTCATCGC
TCAAGTCCTTACACCTAAAGTCGCAATAGAGTTAAGTTGTCAGCTGATCATTCATCATAT
AATCCTATCGACGACTTCAAGATTGATGAAATCAGATTTATTTTAAACGATGTCTTCACT
CAAATATCTTCTGCTACTGCTAAGTTCCCCTAAGAAAACTAGATAAAATACGCTTAAGAT
ACCATAGTACCAAAATTGAATAAATTAATTAAATTTATAGAACAAAAAAATTAAGCTACT
ACATCATATACTCAATACTTTGTTATGGGGTATTTAAGTGTTGTAGACTGTTACTTCTAC
ATAATATCTAAGTACTTCTAGAAGTATTTCCCCTCACTTTATGATGATTACTCACATGTA
TTCGACTTGGTCCTTAATAGCTTTGAAAATATTCCTGAAATAAAAAAATACATCAATTCT
GATAAATATCCAACTCTAGGGTGA


>TTHERM_00794370(protein)
MSKQSQENQQTDLVLGYWPFAGRNMPVIFMLEILNIPYQVNIFDQNTWFGKEKEDLNLDF
PNLPFLIDNSNGMKITEIHNIVNYILYKYEKGRNLQDIHRSSPYTQSRNRVKLSADHSSY
NPIDDFKIDEIRFILNDVFTQISSATAKFPQENQIKYAQDTIVPKLNKLIKFIEQKNQAT
TSYTQYFVMGYLSVVDCYFYIISKYFQKYFPSLYDDYSHVFDLVLNSFENIPEIKKYINS
DKYPTLG