Identifiers and Description

Gene Model Identifier

TTHERM_00794600

Standard Name

APN2 (APurinic Nuclease 2)

Aliases

PreTt21459 | 134.m00139 | APE1

Description

APN2 ExoIII family purinic/apyrimidinic (AP) endonuclease family animal Ape2 subfamily protein; Exodeoxyribonuclease III family protein; AP endonuclease; involved in base excision repair pathway

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF03372 ) endonuclease/exonuclease/phosphatase family
  • ( TIGR00195 ) exodeoxyribonuclease III
  • ( TIGR00633 ) exodeoxyribonuclease III (xth)
  • ( TIGR03395 ) sphingomyelin phosphodiesterase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13338.1 9.997093137033517e-262
Description: exodeoxyribonuclease III family protein (419 aa)
Oxytricha Contig20170.0.g42 1.0004137340105782e-93
Description: Endonuclease/Exonuclease/phosphatase family
DictyBase DDB_G0277701 4.000392704867155e-81
Description: apeA on chromosome: 2 position 8367690 to 8368775
WormBase WBGene00001372 9.996907204735647e-62
Description: locus:exo-3 status:Confirmed UniProt:G5EBR7 protein_id:CAB03235.1
Stentor Coeruleus SteCoe_20039 1.3336148155022614e-34
Description: None
SGD YBL019W 0.000000005997038937208364
Description: APN2 Class II abasic (AP) endonuclease involved in repair of DNA damage; homolog of human HAP1 and E. coli exoIII

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00794600(coding)
ATGATTAAATCTTTTAGATTTTCAGCTTCTAGTCTTTTAAATTTTAGAAACCAATGCTTT
AATACTTAACGTGTAGGTAAGGTATTTTATGCGCCAAAGTTATTAACTTTCCCACTGTTG
AAGTAAAATTTTACTCAGCTCGAAAAAGGCTCAGACTTGCAATAATCAGTAGAAAAATAA
ACTAAAAAGAAAAAAGGTATGAGTAAAATAATTAAAAAATCAAGCTCTATTTCAGAGCCT
GAATAGTCGTAGTCCAGTACTACTACTTAAAAGACTAAAAAGCAGGCTCAATTAGGTGAT
TTCTTTGCTGGAATAAAAAAAAAACCTGAGACCTAAGTTGAAGATAAAGTAGAAATAAAT
ACAGAATTAGGAGATGGAATTTGGAAAGATCGTTAAAATATTAAAATAGCATGTTGGAAT
GTGAATGGATTAAGAGCTGTTTTGAAAAGAGAAGACTTATAAAAGTATATAAAGTAAGAA
AATCCTGATATTCTATGCCTAAATGAAACTAAAATAGATGAATCGAATTTTATAAAAGAA
AAAGTATACAAAGATATTCCTTCAGGCTATTACTAATATTGGAATTTCTGTATACCACCA
ATTAAGGGTTACTCTGGCGTTTCTATTTTCTCTAAAGAAAAAGTCATTAGCATTAAAAAA
GGTATAGATATTGCAGAGCACGAGAACGAAGGAAGGGTTCTTACAGCTGAATTCGATAAA
TTTTATTTAGTTGTAGTTTATGTCCCTAATGCAGGATCGGAATTAGTTAGACTAGATTAT
AGAGTTAATTCGTTTGATAAAGACTTTCAAAATTATTTAAACTAACTAAAATTGAAAAAA
AATGTGATTCTTTGTGGTGATTTAAATGTAGCTCACTAAGAAATAGATATAGCTAATCCC
AAATCTAATAGAAACTCTCCAGGATTTACAATTGAAGAAAGGAATAGCTTTAGTAAATTT
TTAGAAAGTGGATGGATAGATACATTTAGATTTTTATATCCAGAAACTATAAAATATTCT
TGGTGGAGTGTTAGAACTAAAGCTAGAGAATCAAATATAGGATGGAGAATAGATTATTTC
GTTGTAAATAAAGAATTTAAGTCCTCTATTAAAGACTCTATGATAAATAATAATATCTAT
GGAAGTGACCATTGTCCAGTTGAATTTATTTTAAATTTAGATGCTATTTAATAAAATGAA
ACTTCTTCAAACGAAAATACATAAACAAATAAATCTAATTGA


>TTHERM_00794600(gene)
ATGATTAAATCTTTTAGATTTTCAGCTTCTAGTCTTTTAAATTTTAGAAACCAATGCTTT
AATACTTAACGTGTAGGTAAGGTATTTTATGCGCCAAAGTTATTAACTTTCCCACTGTTG
AAGTAAAGTAATAATAATTATAGTATTACCGCCTAAAGATATTAAATAATATATTGAATT
TTTAAAATTTAGATTTTACTCAGCTCGAAAAAGGCTCAGACTTGCAATAATCAGTAGAAA
AATAAACTAAAAAGAAAAAAGGTATGAGTAAAATAATTAAAAAATCAAGCTCTATTTCAG
AGCCTGAATAGTCGTAGTCCAGTACTACTACTTAAAAGACTAAAAAGCAGGCTCAATTAG
GTGATTTCTTTGCTGGAATAAAAAAAAAACCTGAGACCTAAGTTGAAGATAAAGTAGAAA
TAAATACAGAATTAGGAGATGGAATTTGGAAAGATCGTTAAAATATTAAAATAGCATGTT
GGAATGTGAATGGATTAAGAGCTGTTTTGAAAAGAGAAGACTTATAAAAGTATATAAAGT
AAGAAAATCCTGATATTCTATGCCTAAATGAAACTAAAATAGATGAATCGAATTTTATAA
AAGAAAAAGTATACAAAGATATTCCTTCAGGCTATTACTAATATTGGTAATTTTATCAAA
AAACTATAATTTTTAGTTTTACATTTCTAAAAATATTAAAAAACAAATAAATAATTTTAT
AAATAATTAACATAATAATAGATTAATGAATTAAATTAATTTAGCTTTAATATTGTTATA
AGAATTTATTAAATACATAAATTAATAAACTAAAAAGGAATTTCTGTATACCACCAATTA
AGGGTTACTCTGGCGTTTCTATTTTCTCTAAAGAAAAAGTCATTAGCATTAAAAAAGGTA
TAGATATTGCAGAGCACGAGAACGAAGGAAGGGTTCTTACAGCTGAATTCGATAAATTTT
ATTTAGTTGTAGTTTATGTCCCTAATGCAGGATCGGAATTAGTTAGACTAGATTATAGAG
TTAATTCGTTTGATAAAGACTTTCAAAATTATTTAAACTAACTAAAATTGAAAAAAAATG
TGATTCTTTGTGGTGATTTAAATGTAGCTCACTAAGAAATAGATATAGCTAATCCCAAAT
CTAATAGAAACTCTCCAGGATTTACAATTGAAGAAAGGAATAGCTTTAGTAAATTTTTAG
AAAGTGGATGGATAGATACATTTAGATTTTTATATCCAGAAACTATAAAATATTCTTGGT
GGAGTGTTAGAACTAAAGCTAGAGAATCAAATATAGGATGGAGAATAGATTATTTCGTTG
TAAATAAAGAATTTAAGTCCTCTATTAAAGACTCTATGATAAATAATAATATCTATGGAA
GTGACCATTGTCCAGTTGAATTTATTTTAAATTTAGATGCTATTTAATAAAATGAAACTT
CTTCAAACGAAAATACATAAACAAATAAATCTAATTGA


>TTHERM_00794600(protein)
MIKSFRFSASSLLNFRNQCFNTQRVGKVFYAPKLLTFPLLKQNFTQLEKGSDLQQSVEKQ
TKKKKGMSKIIKKSSSISEPEQSQSSTTTQKTKKQAQLGDFFAGIKKKPETQVEDKVEIN
TELGDGIWKDRQNIKIACWNVNGLRAVLKREDLQKYIKQENPDILCLNETKIDESNFIKE
KVYKDIPSGYYQYWNFCIPPIKGYSGVSIFSKEKVISIKKGIDIAEHENEGRVLTAEFDK
FYLVVVYVPNAGSELVRLDYRVNSFDKDFQNYLNQLKLKKNVILCGDLNVAHQEIDIANP
KSNRNSPGFTIEERNSFSKFLESGWIDTFRFLYPETIKYSWWSVRTKARESNIGWRIDYF
VVNKEFKSSIKDSMINNNIYGSDHCPVEFILNLDAIQQNETSSNENTQTNKSN