Identifiers and Description

Gene Model Identifier

TTHERM_00812950

Standard Name

SMC2 (structural maintenance of chromosomes)

Aliases

PreTt30001 | 138.m00121

Description

SMC2 structural maintenance of chromosomes protein; SMC family- C-terminal domain containing protein- condensin subunit- required for division of MIC and MAC.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00005 ) ABC transporter, ATP-binding protein
  • ( PF00435 ) Spectrin repeat
  • ( PF00769 ) Ezrin/radixin/moesin family
  • ( PF01576 ) Myosin tail
  • ( PF02370 ) M protein repeat
  • ( PF02463 ) RecF/RecN/SMC N terminal domain
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( PF06470 ) SMC proteins Flexible Hinge Domain
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF06975 ) Protein of unknown function (DUF1299)
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( TIGR00634 ) DNA repair protein RecN
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein
  • ( TIGR02168 ) chromosome segregation protein SMC
  • ( TIGR02169 ) chromosome segregation protein SMC
  • ( TIGR02211 ) lipoprotein releasing system, ATP-binding protein
  • ( TIGR02473 ) flagellar export protein FliJ
  • ( TIGR03185 ) DNA sulfur modification protein DndD

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02981.1 9.997093137033517e-262
Description: SMC family domain-containing protein (1199 aa)
DictyBase DDB_G0284499 9.997093137033517e-262
Description: smc2 on chromosome: 4 position 2051268 to 2054927
Oxytricha Contig3441.0.g49 9.997093137033517e-262
Description: RecF/RecN/SMC N terminal domain
WormBase WBGene00003367 2.999370583638828e-134
Description: locus:mix-1 Mitotic chromosome and X-chromosome-associated protein mix-1 status:Confirmed UniProt:Q09591 protein_id:CAA87054.1
SGD YFR031C 1.9992362000979228e-56
Description: SMC2 Subunit of the condensin complex; essential SMC chromosomal ATPase family member that forms a complex with Smc4p to form the active ATPase; Smc2p/Smc4p complex binds DNA; required for clustering of tRNA genes at the nucleolus
Stentor Coeruleus SteCoe_15774 0.0000000000002543665647376923
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29237819: Howard-Till R, Loidl J (2018) Condensins promote chromosome individualization and segregation during mitosis, meiosis, and amitosis in Tetrahymena thermophila. Molecular biology of the cell 29(4):466-478

Sequences

>TTHERM_00812950(coding)
ATGTATATAAAAGAAATTATTATTGAAGGTTTCAAGAGTTACGCCACTCGTACAATTATT
AAGGGCTTTGATCAGTAATTCAATGCAATTACAGGTTTTAATGGATCTGGTAAGTCTAAT
ATCTTAGACTCTATCTTATTCGTTCTTGGTTTGAACAAAGATTGGGAACTGCTAAGAGTT
AAGAAGGTTCAAGAATTAGTTTATAAATAAGGTCATGCAGGTATAACAAAAGCAGAAGTT
ACAGTTATTTTCGACAATTCTAACAAAGAATAATCACCTCTTGGTTATGAATCATATGAC
ACAATTTCTGTTACTAGACAAGTCTAATAAGAAAAGAGTAAATACTTCGTTAATGGTACA
AAGCTTACTTTAAATCAAGTCAAAAATATGTTCAGAAGTGTTTAATTAAATATTGACAAT
CCTCACTTCTTGGTTGCTTAAGGTAGAATTACTAAGATCATCAACTTGAAACCTTAGGAA
CTCATTTCTATGCTTGAAGAAACTGCAGGAACTGCTCTCTACAATGAAAAGAAAAGAGAA
AGTGAAAAAATTATTAAGAAAAAAGAGGAAAAGGTTAAGGAAATCAATGATTTGATTGAT
ACAGATATCCAACCTAAAATGAGAAAGTTGAAAGAGGAAAAAGAACAATATTTGATTTGG
AAGAGCAGCGAAGTTGAAATCAACAAAATGGATAGAAAGCTTAAAGCTTATGAATATTTT
AATAAGAACAATCTTTTAAAGGAAAGAATGAGAGAAATAGAAAGCAAGCAAAGCATTCTC
ACACATGCTTAGAGAGAATTAACTAAGGTTACAAATGATTATTAGCAAGTTATTGATGAA
ATGAAAAACCATGGTAGAAAGCAAGATGCTGAAAAGGATAAACAACTCAGTCGTTATGAA
ATGGCACTGAAAAATTTGGAAGATACTATTTAAAGACAAGAAAAAGATCGTGAAACCATT
AAAAAATTTTAAATATCTTCTTTACAAGAATTAAAGAAGTAGGAAAATAAAGTTCGTTTA
TGCGAAGAAAATATTGCTAAATTTGAAAAGGATTTGGAATACTCTAGATAGTAGCTTGCT
GACCTTCAAGCTGAATATGATTAAAAGAAAGAAAATCTCAACGAAGTTAACAGACTTTCT
AAAAATGATTCTGGTAACATAGATGCTGCAAAGGAATAAGTTGATGAATAAATTGTATTC
ACAAAGAATAAACTCAGAAACTTTAAAAACGACATTGCTAAATTAGAAAATTCCATCAAG
CAAAAGCAAAATATCATCAAGAATTAAAAAGAAAATATTGAAAGTGCCTAAAGAGAAAGA
GAAAGTCTTAGCAAAAAGCTTGAAATCTTAGAAAAAGAAATTAAATAAGTTGAAGATGAC
ATCGATAAATGCACATTCAATGTCAATGAGCTCAGAGCAAGAGAAAACGAAAGAGCTAAC
TATGATCAATAAATTATGAAGCTTAATCACAACCTTGAAAATATTTTGAACCAAAATGGT
AACTGGATTTTCAAGCTTCAATTTAGAGACCCTGAACCTAATTTTGATAGAAGCAAAATT
AAGGGAAGAATTTTGACTTTATTCAAAGTAAAATCTCCTGAATATTTCGAAGCACTTGAA
GCTGGTGCAGGTGGAAAATTGCTAAATATTGTTACTGAAGATGAATAAACTTCTAAGTTA
ATGCTTAAAAAGAATTGCTTCTCTTTTAATGTTAGATTTATTCCTAACAATAAGATTGTT
AGCAGAAAGATTGATGAACAAATAGTTTAAGAAGCTTAACGTATTGCAAATGAAATGGGA
GGATGGGCTCTTCCTGCTTATGAACTTATCGAATATGATAAGTATTTAGAAAGAAGTATG
CTTTTTGTATTTGGAAACTTCATTGTTACTTCTAATCAACATATCGCTAAGTAGATAGCC
TTTAATTAGAATGTTAGAATGAGAATCAAGTGTGTCACTCTCGAAGGTGATATTATTGAT
CCTCAAGGTACTTTATAAGGTGGTTATCAAGATAATAGAAACCTCACACTTACTCGTTAT
GCTAATTATAGAAATATTTAAGACGAGAAAGAAGAAATAATCTACAATAAAGGTCAACTT
TAAGAAAGCATCAACTACCTTAAAAAAGAAGAAAATTATTATAATGGTTTGAAGGATGAT
TTAACAAATAAAAAATTCAGATTTGAAAAATTCGCTGAACAATTAAGAAATCTTTCTGGT
CGTGGTATCCAAGAGCAATAAGATAAGCTTGAAAGAGAAATTCAAGATGATATTGAAATG
CTTGCACGTGTTTAAGATCAAGACAAAAAGACTCAAGAAAAGCTTGAAGAATTGAATAAT
GAAAGAGCTAATCTCTCTAAATCTAAAGACACCAAGGAAGTTTGGAAAAAGAAAATCCAA
AAGCTCAAATAAGAAATAGAAGAAAGTGACAAGGAACTATAAAATTTAAACAATCACATT
GCCGACTGTGAAGTCAATATTGAACATAATAAAAAGGATTTAATCAAATCAAAAGACAGA
GTTATCTAAGAAAATAAAAATATAGAAGATCAAAAGAAAAAACTTGAAAGCAATGACTAA
GATTTGAACCAAAAGAGAAAGGAAAACTAAGAATTGAAGAGACAAAAAGATGAGCTTGAG
CTAGAAATTTAGAAGCTCTAAGGTAAGAGAGTTGAGCTTGAAGAAAAAGAAAAAACTCTT
AAGTAAAGAAAAGACGAAATAGAATCTGAAGTTAAGAAGATCGAAGAATTCAACAAAAAA
ATCACTGCAGAAATTACTGACATTCGTCTTTATCTCAATAATTTAGAAAAAGAAAATGAG
TTTATTAGAAATGATAAAGATCTTTTCGGCTAATAAGGAAGTGAGGACTACGACTTCTCT
AAATTTAACTTAAATGAACTTAAGAGAAGATACCATAACACTGTATAGGAACAACAAATA
AGATAAAAGCAAGTAAACTTTAAGGTTGAGGCCATGAGTGAAAAAGTAGAAAAAGATTAT
TAATAACTTAATGAAAAACGCCAAATTCTTGAAAATGATAAGATCCTCCTTTTCAAGAAC
ATGGACGAATTGGATAAGAAAAAGTAAGAAACTTTAGAAAAATGTTATTTGGAAGTTAAT
AAAACATTTGGCTAAATCTTTTCTGATCTTTTGCCAGGTGCTGCAGCTCGTATATAACCT
CCTGAAGGTCAAGATGTTTCTGCTGGTCTTGAATTGGGTGTTGCTTTCAACAATGTATGG
AAAACTTCTCTATCTGAATTATCAGGAGGTTAAAGATCACTTCTTGCTCTTTCTTTCGTA
CTTGCACTCCTTAAATATAAGCCTGCTCCTTTCTATATTTTGGATGAAGTAGATTCCGCT
TTGGATTTGTCTCATACTGAAAATATAGGTTATATGATTTCTCAAAGATTCCAAAACTCT
CAGTTCCTTCTTATTTCCTTAAAAGACGGTATGTATCAAAATGCTAATGTATTGTTTAAA
ACTTCCTTCGTTGACGGTGTATCTAAAGTTGACAGAATTCCATTAAAGAAAAAAATTACA
AATAACAATAAAAAGAAAAAAATGGAAGTTGAGGATGATAAAGAAAATTAAAATTGA


>TTHERM_00812950(gene)
ATGTATATAAAAGAAATTATTATTGAAGGTTTCAAGAGTTACGCCACTCGTACAATTATT
AAGGGCTTTGATCAGTAATTCAATGCAATTACAGGTTTTAATGGATCTGGTAAGTCTAAT
ATCTTAGACTCTATCTTATTCGTTCTTGGTTTGAACAAAGATTGGGAACTGGTAATTAAT
TAATTAATTATATTGACTATTCATAACTAGGCTATTAATTTTTACTTTCAGAGAATTAAT
AAATTATTTTATTTTTTTAATAATTCTAGCTAAGAGTTAAGAAGGTTCAAGAATTAGTTT
ATAAATAAGGTCATGCAGGTATAACAAAAGCAGAAGTTACAGTTATTTTCGACAATTCTA
ACAAAGAATAATCACCTCTTGGTTATGAATCATATGACACAATTTCTGTTACTAGACAAG
TAATTTATCATTTGAAATTCTCTTTGTAATTATTTTGCATGTTAAAAACGATATTGTTTT
TACATTCAATAATAATTTTTTTGAAAAATATTTTAAACTTAGGTCTAATAAGAAAAGAGT
AAATACTTCGTTAATGGTACAAAGCTTACTTTAAATCAAGTCAAAAATATGTTCAGAAGT
GTTTAATTAAATATTGACAATCCTCACTTCTTGGTTGCTTAAGGTAGAATTACTAAGATC
ATCAACTTGAAACCTTAGGAACTCATTTCTATGCTTGAAGAAACTGCAGGTATAAAAATT
ACTTTAGAAGGACAGCAAATAACTATTAAATGCTTGCTATTAATTACCTGATAAAAACAA
AATGTGCTTTCGAAAATCACATAAAAACAGCTTTGATATTAAATAACCATTTTGAATTAT
TTAATTTAATAATAAATAACACTTTAATATAAAAATAAGCCAAGAAATATCTTTTTTAAA
TTAAAAGCAAGAAGTTATTTTTAAAAATGGTTTTTGAGAATATTTTTTGGAATATTTTGA
ATAATTAATTTATCATGAATAATTAAAAATAGGAACTGCTCTCTACAATGAAAAGAAAAG
AGAAAGTGAAAAAATTATTAAGAAAAAAGAGGAAAAGGTTAAGGAAATCAATGATTTGAT
TGATACAGATATCCAACCTAAAATGAGAAAGTTGAAAGAGGAAAAAGAACAATATTTGAT
TTGGAAGAGCAGCGAAGTTGAAATCAACAAAATGGATAGAAAGCTTAAAGCTTATGAATA
TTTTAATAAGAACAATCTTTTAAAGGAAAGAATGAGAGAAATAGAAAGCAAGCAAAGCAT
TCTCACACATGCTTAGAGAGAATTAACTAAGGTTACAAATGATTATTAGCAAGTTATTGA
TGAAATGAAAAACCATGGTAGAAAGCAAGATGCTGAAAAGGATAAACAACTCAGTCGTTA
TGAAATGGCACTGAAAAATTTGGAAGATACTATTTAAAGACAAGAAAAAGATCGTGAAAC
CATTAAAAAATTTTAAATATCTTCTTTACAAGAATTAAAGAAGTAGGAAAATAAAGTTCG
TTTATGCGAAGAAAATATTGCTAAATTTGAAAAGGATTTGGAATACTCTAGATAGTAGCT
TGCTGACCTTCAAGCTGAATATGATTAAAAGAAAGAAAATCTCAACGAAGTTAACAGACT
TTCTAAAAATGATTCTGGTAACATAGATGCTGCAAAGGAATAAGTTGATGAATAAATTGT
ATTCACAAAGAATAAACTCAGAAACTTTAAAAACGACATTGCTAAATTAGAAAATTCCAT
CAAGCAAAAGCAAAATATCATCAAGAATTAAAAAGAAAATATTGAAAGTGCCTAAAGAGA
AAGAGAAAGTCTTAGCAAAAAGCTTGAAATCTTAGAAAAAGAAATTAAATAAGTTGAAGA
TGACATCGATAGTAAATTTTTATTATTTTTATTCTTAAATTCAAAATGCTCTATTAAAAA
TAGAATGCACATTCAATGTCAATGAGCTCAGAGCAAGAGAAAACGAAAGAGCTAACTATG
ATCAATAAATTATGAAGCTTAATCACAACCTTGAAAATATTTTGAACCAAAATGGTAACT
GGATTTTCAAGCTTCAAGTAATGAGACATTCATTATTTTTTCATTTAAATCTTTCAATAC
TTGTTTAATCACTTTTGTTTCAAATCAATAAAATATTTTTTTGAAATAATAAAGTTTAGA
GACCCTGAACCTAATTTTGATAGAAGCAAAATTAAGGGAAGAATTTTGACTTTATTCAAA
GTAAAATCTCCTGAATATTTCGAAGCACTTGAAGCTGGTGCAGGTATATTTGAATATTAA
TTAAATTTATTTTACAAAATAAATAAATAAATGCAATAATTTAGGTGGAAAATTGCTAAA
TATTGTTACTGAAGATGAATAAACTTCTAAGTTAATGCTTAAAAAGAATTGCTTCTCTTT
TAATGTTAGATTTATTCCTAACAATAAGATTGTTAGCAGAAAGATTGATGAACAAATAGT
TTAAGAAGCTTAACGTATTGCAAATGAAATGGGAGGATGGGCTCTTCCTGCTTATGAACT
TATCGAATATGATAAGTATTTAGAAAGAAGTATGCTTTTTGTATTTGGAAACTTCATTGT
TACTTCTAATCAACATATCGCTAAGTAGATAGCCTTTAATTAGAATGTTAGAATGAGAAT
CAAGTGTGTCACTCTCGAAGGTGATATTATTGATCCTCAAGGTACTTTATAAGGTGGTTA
TCAAGATAATAGAAACCTCACACTTACTCGTTATGCTAATTATAGAAATATTTAAGACGA
GAAAGAAGAAATAATCTACAATAAAGGTCAACTTTAAGAAAGCATCAACTACCTTAAAAA
AGAAGAAAATTATTATAATGGTTTGAAGGATGATTTAACAAATAAAAAATTCAGATTTGA
AAAATTCGCTGAACAATTAAGAAATCTTTCTGGTCGTGGTATCCAAGAGCAATAAGATAA
GCTTGAAAGAGAAATTCAAGATGATATTGAAATGCTTGCACGTGTTTAAGATCAAGACAA
AAAGACTCAAGAAAAGCTTGAAGAATTGAATAATGAAAGAGCTAATCTCTCTAAATCTAA
AGACACCAAGGAAGTTTGGAAAAAGAAAATCCAAAAGCTCAAATAAGAAATAGAAGAAAG
TGACAAGGAACTATAAAATTTAAACAATCACATTGCCGACTGTGAAGTCAATATTGAACA
TAATAAAAAGGATTTAATCAAATCAAAAGACAGAGTTATCTAAGAAAATAAAAATATAGA
AGATCAAAAGAAAAAACTTGAAAGCAATGACTAAGATTTGAACCAAAAGAGAAAGGAAAA
CTAAGAATTGAAGGTAAGAAAGCACATTTCATTATTCATAAATTAATTATCTCTTTTATA
TAAATTATATAGAGACAAAAAGATGAGCTTGAGCTAGAAATTTAGAAGCTCTAAGGTAAG
AGAGTTGAGCTTGAAGAAAAAGAAAAAACTCTTAAGTAAAGAAAAGACGAAATAGAATCT
GAAGTTAAGAAGATCGAAGAATTCAACAAAAAAATCACTGCAGAAATTACTGACATTCGT
CTTTATCTCAATAATTTAGAAAAAGAAAATGAGGTAATAAATATCATTTAAAAAATATAT
TTTTTTATTCCTTTTTTATATTTAATTCAATCTTACTTAATATCTATTTTTTAGTAGAAA
TCAAATTCTTTTTATTAATTTATCAAAATATTTCTTCTTTTACTTATTTATTTATTTATT
TATTTATTTATTTATTTATTTATTTATTTATTTGAGCAGATGCTTTGAAAAAAAAATTTA
AAATATCCTTAGCTTGTTTCAAATAAGATTTTAATAATTTAATATTTTGAAAATAATTTA
AAGAAAAATGTGATTAATTATTAGAATTATTGTTAAAATTTATAATAAATAATGAATGTA
TTTGTGCTAATTAAATTTTCTATTTTGATAATAAAATTAGTTTATTAGAAATGATAAAGA
TCTTTTCGGCTAATAAGGAAGTGAGGACTACGACTTCTCTAAATTTAACTTAAATGAACT
TAAGAGAAGATACCATAACACTGTATAGGAACAACAAATAAGATAAAAGCAAGTAAACTT
TAAGGTTGAGGCCATGAGTGAAAAAGTAGAAAAAGATTATTAATAACTTAATGAAAAACG
CCAAATTCTTGAAAATGATAAGATCCTCCTTTTCAAGAACATGGACGAATTGGATAAGAA
AAAGTAAGAAACTTTAGAAAAATGTTATTTGGAAGTTAATAAAACATTTGGCTAAATCTT
TTCTGATCTTTTGCCAGGTGCTGCAGCTCGTATATAACCTCCTGAAGGTCAAGATGTTTC
TGCTGGTCTTGAATTGGGTGTTGCTTTCAACAATGTATGGAAAACTTCTCTATCTGAATT
ATCAGGAGGTAATTAACTAACTATTTGATTATAATTATTTAATTTTATTTATTCAATTTT
ATTTATTTAACAGGTTAAAGATCACTTCTTGCTCTTTCTTTCGTACTTGCACTCCTTAAA
TATAAGCCTGCTCCTTTCTATATTTTGGATGAAGTAGATTCCGCTTTGGATTTGTCTCAT
ACTGAAAATATAGGTAAATAAATAAACTATTTCTTTAAATTAAATTACTTTTAACTTAAA
TTAAATAAAGGTTATATGATTTCTCAAAGATTCCAAAACTCTCAGTTCCTTCTTATTTCC
TTAAAAGACGGTATGTATCAAGTAAATCATTTCATCAAAATTATATTTGTGATTGTAAAA
TATATTTTAATTATTAAAGAATGCTAATGTATTGTTTAAAACTTCCTTCGTTGACGGTGT
ATCTAAAGTTGACAGAATTCCATTAAAGAAAAAAATTACAAATAACAATAAAAAGAAAAA
AATGGAAGTTGAGGATGATAAAGAAAATTAAAATTGA


>TTHERM_00812950(protein)
MYIKEIIIEGFKSYATRTIIKGFDQQFNAITGFNGSGKSNILDSILFVLGLNKDWELLRV
KKVQELVYKQGHAGITKAEVTVIFDNSNKEQSPLGYESYDTISVTRQVQQEKSKYFVNGT
KLTLNQVKNMFRSVQLNIDNPHFLVAQGRITKIINLKPQELISMLEETAGTALYNEKKRE
SEKIIKKKEEKVKEINDLIDTDIQPKMRKLKEEKEQYLIWKSSEVEINKMDRKLKAYEYF
NKNNLLKERMREIESKQSILTHAQRELTKVTNDYQQVIDEMKNHGRKQDAEKDKQLSRYE
MALKNLEDTIQRQEKDRETIKKFQISSLQELKKQENKVRLCEENIAKFEKDLEYSRQQLA
DLQAEYDQKKENLNEVNRLSKNDSGNIDAAKEQVDEQIVFTKNKLRNFKNDIAKLENSIK
QKQNIIKNQKENIESAQRERESLSKKLEILEKEIKQVEDDIDKCTFNVNELRARENERAN
YDQQIMKLNHNLENILNQNGNWIFKLQFRDPEPNFDRSKIKGRILTLFKVKSPEYFEALE
AGAGGKLLNIVTEDEQTSKLMLKKNCFSFNVRFIPNNKIVSRKIDEQIVQEAQRIANEMG
GWALPAYELIEYDKYLERSMLFVFGNFIVTSNQHIAKQIAFNQNVRMRIKCVTLEGDIID
PQGTLQGGYQDNRNLTLTRYANYRNIQDEKEEIIYNKGQLQESINYLKKEENYYNGLKDD
LTNKKFRFEKFAEQLRNLSGRGIQEQQDKLEREIQDDIEMLARVQDQDKKTQEKLEELNN
ERANLSKSKDTKEVWKKKIQKLKQEIEESDKELQNLNNHIADCEVNIEHNKKDLIKSKDR
VIQENKNIEDQKKKLESNDQDLNQKRKENQELKRQKDELELEIQKLQGKRVELEEKEKTL
KQRKDEIESEVKKIEEFNKKITAEITDIRLYLNNLEKENEFIRNDKDLFGQQGSEDYDFS
KFNLNELKRRYHNTVQEQQIRQKQVNFKVEAMSEKVEKDYQQLNEKRQILENDKILLFKN
MDELDKKKQETLEKCYLEVNKTFGQIFSDLLPGAAARIQPPEGQDVSAGLELGVAFNNVW
KTSLSELSGGQRSLLALSFVLALLKYKPAPFYILDEVDSALDLSHTENIGYMISQRFQNS
QFLLISLKDGMYQNANVLFKTSFVDGVSKVDRIPLKKKITNNNKKKKMEVEDDKENQN