Identifiers and Description

Gene Model Identifier

TTHERM_00823440

Standard Name

RABX35 (Rab-like protein)

Aliases

PreTt20418 | 141.m00075 | 3682.m00009

Description

RABX35 miro-like protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18177.1 9.997093137033517e-262
Description: hypothetical protein (358 aa)
WormBase WBGene00016970 0.0000000010002658722841845
Description: status:Confirmed UniProt:Q18898 protein_id:CCD68201.1
Oxytricha Contig968.0.g75 0.0000000020002373268528243
Description: Ras family
SGD YML001W 0.000000007002490258088747
Description: YPT7 Rab family GTPase; GTP-binding protein of the rab family; required for homotypic fusion event in vacuole inheritance, for endosome-endosome fusion, similar to mammalian Rab7
DictyBase DDB_G0285051 0.00000006998394348458725
Description: rab32D on chromosome: 4 position 2597422 to 2598751

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00823440(coding)
ATGGTATCTATCCTTTTAAACGACAAACGAATTGGCATTGAGAAGATGTTAGAGGCATAA
CAAATTGCTAAGGAAAAAAAAAGCTAACAAAAAACTTGTTTGTAAAAAAAAATAGAAGAA
AATCAGAGGGAATAGGTTGCTTGTATCGATTGTAAATCTAATCAAAAATTTAATAAATTA
TCAAAACAATAAATTTGCGAAAATAAGAAAACGTAATAAATGTATTCACAAAACGACGTA
GAGAGAAAATGTCTCAAGTAAAAGAAGAAGCTTAAAATTTTGGCAATTGGAGATTCTCAT
ATTGGGAAGACTACTTTCTTAAAGAATTACTGTTCATAGTAGTACGATTTGAATTATAAA
TCCAACGATAATTTTACTTAATAAAAAGTAAATAAAACTATTGGTTGTGATATTCATGTC
TGCTATCATACTCCTAACACCAAAGCTCTTATCACTGAAACAAAATAAAATGATTCACTA
TAATACTAAGAAGAATACACTGTTTAGTTTATAGACATGGCAGGAGAAAATAAATAGAGA
GAGTTTTTGAATGTCTTTATTAGGAATAAACTACAAAAATTAGATGCAATCTTATTCTTT
TTTGATTTGACTAATTTAAATACATTCAAAAACTTTTACAAGTGGCTAATGGCTATATTC
CATAACAGTTAAAGTAAAAAGGACTATGCCTGTGTGTGGTAGATTCCCTTTTTATTGATT
GGGACAAAAACTGATTAAATACCATCTAAATATTAAGCTTAAATAAAATAAAAGTTACTT
AACTAACTAAATAAAATGTTTAAGTGCACACGTGGAGAGAACCTTATCTTTTTAAACGCT
AACAACATTGAAAGCTCAAATTAAAAAGTAGAAATGTCCATGTTCCATTTATTTTTAAGT
GAAATCTGCATTGAAAAGACAATGAAAAATATGAAACAATCAACTAATTCTTCTTTATTT
TCATTTTAAGGTTAAAGTGAATACAATCCATAAGAACTCTTAAGCGGTCTCAACAAAAAC
ACCTAAAAATACTGCTTAAATAATGATAATTATAAGAATAAAAGAATAATTGAAGAAGAT
AAAAACTTTATGCAAATCGTTTTAGAAGTTAATTAATTCTCTGAATATAAAAAAGCTTGG
TAAAATCAAGTTTTTAATTTAACCTCAAGGGTTATTGTTATCAAAGAGCGCATTACTGAA
ATTATTTATACTACTTTTAGAAAAAGCGAAGATGAGCTTGTTCTTCCTCATTCTAATTTA
GAGTGA


>TTHERM_00823440(gene)
ATGGTATCTATCCTTTTAAACGACAAACGAATTGGCATTGAGAAGATGTTAGAGGCATAA
CAAATTGCTAAGGAAAAAAAAAGCTAACAAAAAACTTGTTTGTAAAAAAAAATAGAAGAA
AATCAGAGGGAATAGGTTGCTTGTATCGATTGTAAATCTAATCAAAAATTTAATAAATTA
TCAAAACAATAAATTTGCGAAAATAAGAAAACGTAATAAATGTATTCACAAAACGACGTA
GAGAGAAAATGTCTCAAGTAAAAGAAGAAGCTTAAAATTTTGGCAATTGGAGATTCTCAT
ATTGGGAAGACTACTTTCTTAAAGAATTACTGTTCATAGTAGTACGATTTGAATTATAAA
TCCAACGATAATTTTACTTAATAAAAAGTAAATAAAACTATTGGTTGTGATATTCATGTC
TGCTATCATACTCCTAACACCAAAGCTCTTATCACTGAAACAAAATAAAATGATTCAGTA
AAAATTATTTCATTATTTTATACATTTTTTCTTCATAATTTATTTCAATCAAACAATAAT
GAACATAATTTTAAACATTGTTTTTTGATTTTAAACTTTTTAGCACTTCATGCTTTTTAA
ATTCCAAATTCATTTTGATAAATTTTTGAGTTTGTAAATGAATATTTTAAACGCATCTTT
GGAATTTTTTTAGTAAAATTTAAACATTTTTAAGAATCCAATTCTCTTAAAACATTTTAT
GAGCTATTTTTTTTTAGTTAATTCAACAATTTAAAGTTTATTATAGTAAAATTAAGTGCA
AATTTTAACTATAAAATTAAGTAATATATTTAATAAATTTTTTTTTGTCTTAAAATAGCT
ATAATACTAAGAAGAATACACTGTTTAGTTTATAGACATGGCAGGAGAAAATAAATAGAG
AGAGTTTTTGAATGTCTTTATTAGGAATAAACTACAAAAATTAGATGCAATCTTATTCTT
TTTTGATTTGACTAATTTAAATACATTCAAAAACTTTTACAAGTGGCTAATGGCTATATT
CCATAACAGTTAAAGTAAAAAGGACTATGCCTGTGTGTGGTAGATTCCCTTTTTATTGAT
TGGGACAAAAACTGATTAAATACCATCTAAATATTAAGCTTAAATAAAATAAAAGTTACT
TAACTAACTAAATAAAATGTTTAAGTGCACACGTGGAGAGAACCTTATCTTTTTAAACGC
TAACAACATTGAAAGCTCAAATTAAAAAGTAGAAATGTCCATGTTCCATTTATTTTTAAG
TGAAATCTGCATTGAAAAGACAATGAAAAATATGAAACAATCAACTAATTCTTCTTTATT
TTCATTTTAAGGTTAAAGTGAATACAATCCATAAGAACTCTTAAGCGGTCTCAACAAAAA
CACCTAAAAATACTGCTTAAATAATGATAATTATAAGAATAAAAGAATAATTGAAGAAGA
TAAAAACTTTATGCAAATCGTTTTAGAAGTTAATTAATTCTCTGAATATAAAAAAGCTTG
GTAAAATCAAGTTTTTAATTTAACCTCAAGGGTTATTGTTATCAAAGAGCGCATTACTGA
AATTATTTATACTACTTTTAGAAAAAGCGAAGATGAGCTTGTTCTTCCTCATTCTAATTT
AGAGTGA


>TTHERM_00823440(protein)
MVSILLNDKRIGIEKMLEAQQIAKEKKSQQKTCLQKKIEENQREQVACIDCKSNQKFNKL
SKQQICENKKTQQMYSQNDVERKCLKQKKKLKILAIGDSHIGKTTFLKNYCSQQYDLNYK
SNDNFTQQKVNKTIGCDIHVCYHTPNTKALITETKQNDSLQYQEEYTVQFIDMAGENKQR
EFLNVFIRNKLQKLDAILFFFDLTNLNTFKNFYKWLMAIFHNSQSKKDYACVWQIPFLLI
GTKTDQIPSKYQAQIKQKLLNQLNKMFKCTRGENLIFLNANNIESSNQKVEMSMFHLFLS
EICIEKTMKNMKQSTNSSLFSFQGQSEYNPQELLSGLNKNTQKYCLNNDNYKNKRIIEED
KNFMQIVLEVNQFSEYKKAWQNQVFNLTSRVIVIKERITEIIYTTFRKSEDELVLPHSNL
E