Identifiers and Description

Gene Model Identifier

TTHERM_00823980

Standard Name

PARP4 (Poly [ADP-Ribose] Polymerase 4)

Aliases

PreTt20466 | 141.m00123 | 3682.m00057

Description

PARP4 poly(ADP-ribose) polymerase family WGR domain protein; WGR domain containing protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF00644 ) Poly(ADP-ribose) polymerase catalytic domain
  • ( PF02877 ) Poly(ADP-ribose) polymerase, regulatory domain
  • ( PF05406 ) WGR domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18135.1 9.997093137033517e-262
Description: WGR domain-containing protein (614 aa)
Oxytricha Contig12012.0.g59 8.000542080162695e-100
Description: Poly(ADP-ribose) polymerase catalytic domain
DictyBase DDB_G0292820 6.997716170296885e-95
Description: adprt2 on chromosome: 6 position 2124835 to 2127096
WormBase WBGene00004049 6.996751372006089e-64
Description: locus:pme-1 Poly(ADP-ribose) polymerase pme-1 status:Confirmed UniProt:Q9N4H4 protein_id:CCD73512.1
Stentor Coeruleus SteCoe_27180 3.4811068399043105e-57
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):

Sequences

>TTHERM_00823980(coding)
ATGCCTCCTAAAAGAGCTACTAGATCTTAATCTGCAGCAGCAGCAACTAAAGGTAAATAG
GCTGCTACAAAAACTACAAAAAAAGATGCCAAGATTGAGGATAAAAAAGTGACTAGAGGA
AGAAAAGCAGCCACTAAATCTCCTTCTCCTTCCCCTTCACCTAAAAAAACCCAAAAAGGT
AAACCTGCAGCAGCTTCTAAATCTAAATCTAAAGATACTAAAGTCGCAACAGTAGATAAG
AAAAACACAAAAGCAGCTTAGAAAACTACTTAAAAAACAAAGTAAGCAAAAACAGCACCA
GCACCTTCTCCCAAAAAAACCAATAAAAGAAAAGCTAAGAGTGTATCTCCCTCCCCAGAT
ACAAAGGCCTAAACTAAAAAGAGTCCTGTCAAAAAAGTCAAAGATGTACCCAAAAAAGAT
GAATCTGAAGATGAGAAAAAAACTGTTAAATAGATCGTTAAAGGTAAATGTGCAGTTGAT
TAGTATGTACCAAATTCAACACAATACACAGTTCTATAAGAAGGAAACTAAATTTACAAT
CTTACTTTGAATCAATCAAATGTTGATGCAAACAATAACAAATTCTATCTTGGATAGGTG
CTTGTTAAAGATGGAACTAATCAATACTCCGTTTTCTTTAGATGGGGAAGAGTTGGTGTT
CCAGGACAATAAAGCATTAAAGTTTGTTCAAGTAAATTTGAAGCTATTAGCGAATTCTAA
AAAAAGAAAAGCGATAAAATTAAAGGAGGTTATACTGAAATTTTCATCAAATATGGTGAA
GATGATGAAGATGAAAAGCCAAAGAAAAAATAAACTACTTAACCTACAAAGAGAAAAGAT
TGTACTTTATCTGCTGCAGTTCAAACCTTGATAAACGACATTTTTGATATGAAAATGATT
GAGAGTACAATTAAAGAAATAGGTTATGATTCTAAAAAGATGCCTTTAGGTAAACTTGAC
GATAAAACAATTAAATAAGCTTACACTGTTCTCAAAGATCTTTTAGATGCTGTAAAAAAT
AATAAAGTTAGTGATTATGGTCGTTATTCTAGTTAATTCTACTCCCTTATTCCTCATGAT
TTTGGTTTCTAAAAAATGAGTAACTTCATTTTAAAAACTGAGGAATAAGTGCGTAAGAAG
CTTTCAATGCTTTAAGATTTATCTGACTTAAAAATTGCAACTCAATTACTTAAAGAATCA
GATTCAGATGACTCAATCTTAGATTAAAACTATAAAAAATTAAATGCAGAAATAAAAGAA
GTCACAGATAAAAAGACATTAGACATTATTAAGAATTATGTTAATCAAGGCAAAGGACAT
TATAGCCCTAAGATTTTAGAAATATTTTCAGTAAAAAGAAAAGGCGAGCAAGAACGTTAC
TCAAAAAATATTGGAAACGATACACTCTTATGGCATGGGTCCCGTATTTCAAACTTTGTT
GGTATATTATCTTAAGGTCTTCGTATTGCTCCTCCTGAGGCTCCTGTTACTGGTTATAAT
TATGGTAAGGGTATTTACCTTGCAGATTAATTTACTAAATCTTGTGATTATTGTGCAGGT
AATAGTGATGGTATCCATTACATCATGCTCATAAAGGCTGCTCTAGGAACTCCTAACAAA
ATAGAAAAAACTGATTATAATGCTAATAATCTTCCTAAAGGAACTCATTCTTGCTGGGGT
TGGGGTACTCATGGTCCTGAAGAATTCATAACATTTAATGGAGTTAAAGTACCTAAAGGC
TAGGAAGTTAGAACTAAATCTAAGCACTATATGAAATATAACGAGTTTATCATTTATGAT
ATTGCTTAAGCTCAAATAGATTATCTAATTAGATTTAAAAAGTACTGA


>TTHERM_00823980(gene)
ATGCCTCCTAAAAGAGCTACTAGATCTTAATCTGCAGCAGCAGCAACTAAAGGTAAATAG
GCTGCTACAAAAACTACAAAAAAAGATGCCAAGATTGAGGATAAAAAAGTGACTAGAGGA
AGAAAAGCAGCCACTAAATCTCCTTCTCCTTCCCCTTCACCTAAAAAAACCCAAAAAGGT
AAACCTGCAGCAGCTTCTAAATCTAAATCTAAAGATACTAAAGTCGCAACAGTAGATAAG
AAAAACACAAAAGCAGCTTAGAAAACTACTTAAAAAACAAAGTAAGCAAAAACAGCACCA
GCACCTTCTCCCAAAAAAACCAATAAAAGAAAAGCTAAGAGTGTATCTCCCTCCCCAGAT
ACAAAGGCCTAAACTAAAAAGAGTCCTGTCAAAAAAGTCAAAGATGTACCCAAAAAAGAT
GAATCTGAAGATGAGAAAAAAACTGTTAAATAGATCGTTAAAGGTATTTAATTGATATTA
AATAATTAACATAAAAATAATCATTATATTACTGGTATCATTTATATTTAATACTTAAAT
ATTTTTTATAAAGGTAAATGTGCAGTTGATTAGTATGTACCAAATTCAACACAATACACA
GTTCTATAAGAAGGAAACTAAATTTACAATCTTACTTTGAATCAATCAAATGTTGATGCA
AACAATAACAAATTCTATCTTGGATAGGTGCTTGTTAAAGATGGAACTAGTATAAATCCT
ATTTTTTTAAAAAAAATATATTAAATTTATTTCTATAAAAAGATCAATACTCCGTTTTCT
TTAGATGGGGAAGAGTTGGTGTTCCAGGACAATAAAGCATTAAAGTTTGTTCAAGTAAAT
TTGAAGCTATTAGCGAATTCTAAAAAAAGAAAAGCGATAAAATTAAAGGAGGTTATACTG
AAATTTTCATCAAATATGGTGAAGATGATGAAGATGAAAAGCCAAAGAGTAATTTTAATA
GAATTAATTAATTAATTTATTTATTTATTTTTAAAAATGTGTTGAAATTAGAAAAATAAA
CTACTTAACCTACAAAGAGAAAAGATTGTACTTTATCTGCTGCAGTTCAAACCTTGATAA
ACGACATTTTTGATATGAAAATGATTGAGAGTACAATTAAAGAAATAGGTTATGATTCTA
AAAAGATGCCTTTAGGTAAACTTGACGATAAAACAATTAAATAAGCTTACACTGTTCTCA
AAGATGTAACTAGAAATTAAAAACACTTAAAATTTAAATTTAAAATACCTTTTATGTGAT
ATTAAATAGCTTTTAGATGCTGTAAAAAATAATAAAGTTAGTGATTATGGTCGTTATTCT
AGTTAATTCTACTCCCTTATTCCTCATGATTTTGGTTTCTAAAAAATGAGTAACTTCATT
TTAAAAACTGAGGAATAAGTGCGTAAGAAGCTTTCAATGCTTTAAGATTTATCTGACTTA
AAAATTGCAACTCAATTACTTAAAGAATCAGATTCAGATGACTCAATCTTAGATTAAAAC
TATAAAAAATTAAATGCAGAAATAAAAGAAGTCACAGATGTAAACATTTAAATTATTTTA
GTTAAAAGAAATTGAGATAAAAATATCTTATCATTTTTAATGTTTGTTTTAAGCTTTAAA
AAAATAAATTCTAATATCTTCAAATTTGAGAAAAGTTTAATGAAGAAAATATACAACTAA
GCAAGCATAATTAAATTCATAGGTTTTGATTTAAAATAAAATAAAAAACATTTTGAGATC
TAATAGATTAAAATATTAATTTATTAAGTTAGTTAATTAGTTGGTTACACTTAGAAATCA
TTTATTTTTTTTTGATTAAGTTAGAATTCAAGTGATAAAGCATTATTTATTTTTAATAAT
TTAATAGAAAAAGACATTAGACATTATTAAGAATTATGTTAATCAAGGCAAAGGACATTA
TAGCCCTAAGATTTTAGAAATATTTTCAGTAAAAAGAAAAGGCGAGCAAGAACGTTACTC
AAAAAATATTGGAAACGATACACTCTTATGGCATGGGTCCCGTATTTCAAACTTTGTTGG
TATATTATCTTAAGGTCTTCGTATTGCTCCTCCTGAGGCTCCTGTTACTGGTATAAATTA
ATAATTAAATAGATAAAATATCCAATATGAATTGATTTTTTTTAATTTTAGGTTATAATT
ATGGTAAGGGTATTTACCTTGCAGATTAATTTACTAAATCTTGTGATTATTGTGCAGGTA
ATAGTGATGGTATCCATTACATCATGCTCATAAAGGCTGCTCTAGGAACTCCTAACAAAA
TAGAAAAAACTGATTATAATGCTAATAATCTTCCTAAAGGAACTCATTCTTGCTGGGGTT
GGGGTACTCATGGTCCTGAAGAATTCATAACATTTAATGGAGTTAAAGTACCTAAAGGCT
AGGAAGTTAGAACTAAATCTAAGGTAAATAATTTTAAAAATTACTATTTTATTCATTTGT
TTCTATTTAATTTATTAGCACTATATGAAATATAACGAGTTTATCATTTATGATATTGCT
TAAGCTCAAATAGATTATCTAATTAGATTTAAAAAGTACTGA


>TTHERM_00823980(protein)
MPPKRATRSQSAAAATKGKQAATKTTKKDAKIEDKKVTRGRKAATKSPSPSPSPKKTQKG
KPAAASKSKSKDTKVATVDKKNTKAAQKTTQKTKQAKTAPAPSPKKTNKRKAKSVSPSPD
TKAQTKKSPVKKVKDVPKKDESEDEKKTVKQIVKGKCAVDQYVPNSTQYTVLQEGNQIYN
LTLNQSNVDANNNKFYLGQVLVKDGTNQYSVFFRWGRVGVPGQQSIKVCSSKFEAISEFQ
KKKSDKIKGGYTEIFIKYGEDDEDEKPKKKQTTQPTKRKDCTLSAAVQTLINDIFDMKMI
ESTIKEIGYDSKKMPLGKLDDKTIKQAYTVLKDLLDAVKNNKVSDYGRYSSQFYSLIPHD
FGFQKMSNFILKTEEQVRKKLSMLQDLSDLKIATQLLKESDSDDSILDQNYKKLNAEIKE
VTDKKTLDIIKNYVNQGKGHYSPKILEIFSVKRKGEQERYSKNIGNDTLLWHGSRISNFV
GILSQGLRIAPPEAPVTGYNYGKGIYLADQFTKSCDYCAGNSDGIHYIMLIKAALGTPNK
IEKTDYNANNLPKGTHSCWGWGTHGPEEFITFNGVKVPKGQEVRTKSKHYMKYNEFIIYD
IAQAQIDYLIRFKKY