Identifiers and Description

Gene Model Identifier

TTHERM_00825240

Standard Name

MRNC41 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt03988 | 142.m00085 | 3683.m00018

Description

MORN repeat protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18300.1 9.997093137033517e-262
Description: hypothetical protein (420 aa)
Oxytricha Contig13677.0.1.g35 6.000094003473941e-109
Description: MORN repeat
Stentor Coeruleus SteCoe_23474 1.6889118802245324e-48
Description: None
DictyBase DDB_G0349488 0.0000000000000030004923591262316
Description: DDB_G0349488 on chromosome: 2 position 6912714 to 6914186
WormBase WBGene00002179 0.0000000010002658722841845
Description: locus:jph-1 status:Confirmed UniProt:Q22667 protein_id:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00825240(coding)
ATGGGTAATACATGCTGTTGTACCAACTAAGCATAAGATTAGTAGAATTAAATAGAAGGA
ATAACTTAACGCAAGCCTGAGCTTCCTGAAAATGCATTTGATGATGACTAAGAATAAAAT
ACTACAACTAAAATAGGAAAAACTACTAAAGTAAATGCAGCTCCTCATAATGATGATTAA
ACAAATGCAAATTCATTATAGAATGATAGAAAAGACTCAAGTAGAAGCATAACTAAAGAT
GTTTATGATGATAATTCAAAAAATGCAGTGACTTATTCTCATAATATAGATCCTGGTTAA
TAATTTCATCTTCCTCTTCCAGATATTGCAAAGCCTATAACTGTTATACCCGAATTTCTT
AATGAAAATGCAAAAAATACTCTTCTTTCTTAAGGAGACTTTTTATATGATGAAGATGCT
CCTGATGATAAGCAATTACCACATGCAGGTCCATATGAATTTGAAAACGGATCAGTTTAT
ATTGGGTAATGGAAAAATGGCAATAGACATGGTCGTGGAAAATAATATTGGAATGATGGA
AGCCTTTATGAAGGATACTGGAGAAATAATATGGCAGAAGGAAAAGGTAGATTAGTCCAC
TCTGATGGTGACATATATATTGGTAGATGGCACAAAGATAAGGCTAATGGAATGGGAGTA
TATCTACACATAGATGGAGCTAAATACGAAGGTGAGTGGATTGATGATAAGCAAAATGGT
ATGGGTACAGAATCTTGGCCAGATGGAGCAGTGTACAAAGGATAATATGTAGATGGAAAA
AAAGAAGGATATGGAAAGTTTATGTGGGCTGATGGCTCAGTATATGAAGGATAATTTATA
AAAAATAATATACATGGCAAAGGTACCTATAGCTGGCCTGATGGAAGATAGTATATTGGT
GATTGGGTAGATAACAGAATGGAAGGAAAGGGAGTATTTACTTGGAGTGATGGAAGAAAG
TATGAAGGAGAATATTTGGATGATAAAAAGCATGGATATGGTGTTTTTGAATGGCCAGAT
GGAAGAGTGTATAAGGGATATTGGGAAAATGGTAAATAACATGGTGTTGGTTATTTTACA
GGACCTAATGCTATAGAGAAAAAGGGTGAGTGGAAGAATGGCAAAAGAGAAAGATGGATC
TCTGAAGATGATGAAAATAAAGAAAAACAAAAATGA


>TTHERM_00825240(gene)
ATGGGTAATACATGCTGTTGTACCAACTAAGCATAAGATTAGTAGAATTAAATAGAAGGA
ATAACTTAACGCAAGCCTGAGCTTCCTGAAAATGCATTTGATGATGACTAAGAATAAAAT
ACTACAACTAAAATAGGTAATTAGTTAAAATTTAACGAAAAGGATATTTAAATATAAAAA
GACTATATCAATAGTTTAAGCTTTAATGAGCTATGCAAATTAAATAATACTAATATCAAA
CACTCTAAAAAAGCAACTCAGATTCATTTTTATATTATAGAAATAAATATAAAGTATTAA
TTTATAATTTTTACAGGAAAAACTACTAAAGTAAATGCAGCTCCTCATAATGATGATTAA
ACAAATGCAAATTCATTATAGAATGATAGAAAAGACTCAAGTAGAAGCATAACTAAAGAT
GTTTATGATGATAATTCAAAAAATGCAGTGACTTATTCTCATAATATAGATCCTGGTTAA
TAATTTCATCTTCCTCTTCCAGATATTGCAAAGCCTATAACTGTTATACCCGAATTTCTT
AATGAAAATGCAAAAAATACTCTTCTTTCTTAAGGAGACTTTTTATATGATGAAGATGCT
CCTGATGATAAGCAATTACCACATGCAGGTCCATATGAATTTGAAAACGGATCAGTTTAT
ATTGGGTAATGGAAAAATGGCAATAGACATGGTCGTGGAAAATAATATTGGAATGATGGA
AGCCTTTATGAAGGATACTGGAGAAATAGTAAATTTATTCTACTAAAAAATAATAAAGTT
TTTTTGAAATTATTTAATCAATTTTTAGTTTAAAAAAATAAAACTTTAAAATAATATTTT
TATAAATCAAGATATGGCAGAAGGAAAAGGTAGATTAGTCCACTCTGATGGTGACATATA
TATTGGTAGATGGCACAAAGATAAGGCTAATGGAATGGGAGTATATCTACACATAGATGG
AGCTAAATACGAAGGTGAGTGGATTGATGATAAGCAAAATGGTATGGGTACAGAATCTTG
GCCAGATGGAGCAGTGTACAAAGGATAATATGTAGATGGAAAAAAAGAAGGATATGGAAA
GTTTATGTGGGCTGATGGCTCAGTATATGAAGGATAATTTATAAAAAATAATATACATGG
CAAAGGTACCTATAGCTGGCCTGATGGAAGATAGTATATTGGTGATTGGGTAGATAACAG
AATGGAAGGAAAGGGAGTATTTACTTGGAGTGATGGAAGAAAGTATGAAGGAGAATATTT
GGATGATAAAAAGCATGGATATGGTGTTTTTGAATGGCCAGATGGTAAAAATAAAAATTT
TTTTAATTAGTTTTAAATATTTTTTTTTAATAGGAAGAGTGTATAAGGGATATTGGGAAA
ATGGTAAATAACATGGTGTTGGTTATTTTACAGGACCTAATGCTATAGAGAAAAAGGGTG
AGTGGAAGAATGGCAAAAGAGAAAGATGGTATAAAGATTATTAATTTTACTTTACTAAAA
AACTTTAAATCACTTTAAAAAATATAGGATCTCTGAAGATGATGAAAATAAAGAAAAACA
AAAATGA


>TTHERM_00825240(protein)
MGNTCCCTNQAQDQQNQIEGITQRKPELPENAFDDDQEQNTTTKIGKTTKVNAAPHNDDQ
TNANSLQNDRKDSSRSITKDVYDDNSKNAVTYSHNIDPGQQFHLPLPDIAKPITVIPEFL
NENAKNTLLSQGDFLYDEDAPDDKQLPHAGPYEFENGSVYIGQWKNGNRHGRGKQYWNDG
SLYEGYWRNNMAEGKGRLVHSDGDIYIGRWHKDKANGMGVYLHIDGAKYEGEWIDDKQNG
MGTESWPDGAVYKGQYVDGKKEGYGKFMWADGSVYEGQFIKNNIHGKGTYSWPDGRQYIG
DWVDNRMEGKGVFTWSDGRKYEGEYLDDKKHGYGVFEWPDGRVYKGYWENGKQHGVGYFT
GPNAIEKKGEWKNGKRERWISEDDENKEKQK