Identifiers and Description

Gene Model Identifier

TTHERM_00825460

Standard Name

RAD4 (RADiation sensitive 4)

Aliases

PreTt04010 | 142.m00107 | 3683.m00040 | XPC1

Description

RAD4 DNA repair protein Rad4; DNA repair protein Rad4 containing protein; homolog of human XPC

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF03835 ) DNA repair protein Rad4
  • ( PF06696 ) Streptococcal surface antigen repeat

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18272.1 9.997093137033517e-262
Description: DNA repair protein Rad4 containing protein (932 aa)
Oxytricha Contig15291.0.g9 9.003144504923815e-42
Description: Rad4 beta-hairpin domain 3
DictyBase DDB_G0292296 1.000116773704384e-19
Description: xpc on chromosome: 6 position 1414792 to 1417980
WormBase WBGene00022296 1.000361553249356e-16
Description: locus:xpc-1 status:Partially_confirmed UniProt:Q9N4C3 protein_id:CCD73179.1
SGD YER162C 0.0000009995106777214876
Description: RAD4 Protein that recognizes and binds damaged DNA (with Rad23p) during nucleotide excision repair; subunit of Nuclear Excision Repair Factor 2 (NEF2); also involved, with Rad23p, in turnover of ubiquitylated proteins

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_00825460(coding)
ATGGATTCAAATGAAGATCTTGATTTCAATGATGAATTTGAAGAAGTAGATGAAAAATAA
AATGAAGATAGGATAAGCTTTGGATCTGATGACGAAAATAATTAGTAGAAGTAATCAGAT
TCAGAAGATAATCTCTATTTTGATAATAAAATCAAAAATAATAAAAAATAAAAAAATAAA
TTGGAAGACAGCTATGAAGATGATAGAATGATTAATGAAGATGAAAATTAAGATATCGAT
TTTTTAAATGCCATTTGTAATAAAGATGAAGAAGGTTAAAAAAACATGAGAGAAGACTTT
TTAAGTTTGATTAAAACTGCAGGAGATGATGATACAATTCAGAAATTAATGTAAGAAAGA
CAACAATTAGGTAGAACTGAAGGAGGGAGAGAGAATCCTCATATTATTAAAGAATAAATG
ATTCTTGAGAAAATGCTTGCAAAACAAAAAAGATATGATGAAATTATGTATGAAAAAGAA
AAGCTTGAATTTCTAAAAAAAACTAGAAAGATTCGCTAAAATCCAGAAGAATACAGGAAT
TTTATTAAGTGTTTTGTATTATGCGAAATTTCTTCTACTTTCTACTTTCTATAGTCTCAT
TTGGAAGATGAGTATTTAAAAGCTAAGATAATATCTTAATTTTCTTTAAAAGATTTAAAT
TTTTTACTTTCCATGAAAAACTATCCTGAAAAATACTCAACTAGAAGTATTATAAAAACT
GTTAATTATCACATATAGCAATACTTTACTTATAAATGGAAGAAAGAATAAATTGAATTT
CATAAAAATTTAGATGAAGGAATAGAGGTAGGCTACTCTTAAATGACATTAATTGCCTTG
ATCTTATTTGAATTTATTGGTATGAAAGTTAGATTTTCCAAAATTGTAGACATGAGATAC
CTCAACCTTGACAAAAAACACAATTCAAGGATCAAAGAAAGTAAAAGAAGTTCAAATTAG
TCTTAAGAATCCACACATAGCAATTAAAAGCGTACTAGAGAATCTATAGTAAGTAGTGTT
GTTTAAAATAAGAGAGCTGCACGTTTTTCAGATATGGCTTCTAGAATTACTGCTAAAATA
ATGAATTAGACTTAAATGATAGAAGATTAAATAGATAGTGATTAAAGTGACAGTGATGAT
GAAGATTATTAAACAAAAAAAAATGATAAAAAATAATAATAAAAAGAAAGCAATGATTTA
TTTGACCAAATGCTGTCAAATTTTAAGTTTGATAAAAAAAGCACTAACAATTCATCAATG
ATTAGTTTTAGTAATTAAAAAAAAAATTAACAAGAAGAAGATTCAATTGTTTCAACTGCC
TCATCTACCTTTTAGACTGATCCTAAAAAATTTGATTTTAGAAAGTATTTAAATAAAGGA
AAAAAGCAAGATGATGATAAAAGCTCCTTATTGAAAATAGATAACTAAACATAAAAATAA
GAAGAAGAAGAAATTAAATTAGTTAATAAAAAATTAAGTAATTTGAAGAAGTTAGATAGT
TTATCTGATGTAGAAAAATGCGAAAGCGAAGTTGAAAAAGAAGAGGAAACTTTAAATCCA
TTTAATTTTGCTTTTTCTAAAAAAAAATTTAAAAAGACTTAACAGGACTTAATATAGACT
TAGTAGACAAATTAAACAGAATAGGATTCAAAGCTTTTGGAAAATGACTAAAATTAATAA
CAATAAAAGTTATTAAAAAGTGATTTCTATCAAAGTTCTGAAATAAAGTATTGGCTTGAA
GTTTATGATGAAAAGAGTTAGCAATGGATTTGTTTTGATGCTGTTTAGAATGAAATTTTA
GAAAGATTCTAAATTTTGTTAAAATAAAATAGTATACCTGTTTTATTCATAGTTGGATAT
AATAAATTAGAATTTAAAAATGAAAAATTAAAAGAATATGTTCATAACAAAAGATCTATG
AAAAATTTGTTTTTATTTGATATTACTGATATACACTGTGATAGGTATCCGAAAATTTAG
GTAAGTAGAAGAGAGTTGAATTTCGATTATTGGTGGAAAAATCTTCTTTAACATGTTTCA
TTTCTTGGAAATCCAGAATTACTATAAGACGAATATAAACCCTAAGTAATTAGTGAAAGA
GAAACAAAAATATAAATGTAAAAATCTTAAATCCCTTAATCATATCCTGAGTTTAAAGCA
AGTGAAATTTATATTACTAAGTCAATGCTTTAAAAGTATTAAGGTTTACATCCAAATGCA
TAAAAGACAAATCTTACATTTAAAGACGAAGACGTATATTTTAAAGAATATGTCGTTGAT
TTGCATGCAAAAACTAGATGGAGATCCTACTAAAGATCAGTTAAGCCTGATGAGAAGCCT
GTTAAATAGGTTCAATCGATTTTAGGTAACAAAAAAATGGTAGATTTGTTTGGATTCTGG
TAAACTGAAGAGTTAGTATACAAAATCAGAGATGATGGAACTCTCCCAAGAAATGAATAT
GGTAACTGGGAGACGTTTGCTGGTGATCCACCTGAAGGAACAGTTTTGATTGAAATCTAA
GGATTACCTAAGTTGCTAAAAAAACATAACATAGAGTATGTAGAAGCAGTTTGCGGATTT
GAATCGACAGCATCTGGTAGATCTCATGTGGTTAAAAATGGTATACTAGCCCACAAGAAA
GATGAAGAAAGAATAAGATAAATTTATTAAGATAACTATGAAATTATGAAAGCTCAGTAA
GCAGAAAATCTTAAAAAAGAGCTTATGGGATTTTGGAGAAAAATATTTAAAGGAGTTTTA
CTGAAAAAGAGTATTTCAGATAGATAAAATAAAATAAGTATGTGA


>TTHERM_00825460(gene)
ATGGATTCAAATGAAGATCTTGATTTCAATGATGAATTTGAAGAAGTAGATGAAAAATAA
AATGAAGATAGGATAAGCTTTGGATCTGATGACGAAAATAATTAGTAGAAGTAATCAGAT
TCAGAAGATAATCTCTATTTTGATAATAAAATCAAAAATAATAAAAAATAAAAAAATAAA
TTGGAAGACAGCTATGAAGATGATAGAATGATTAATGAAGATGAAAATTAAGATATCGAT
TTTTTAAATGCCATTTGTAATAAAGATGAAGAAGGTTAAAAAAACATGAGAGAAGACTTT
TTAAGTTTGATTAAAACTGCAGGAGATGATGATACAATTCAGAAATTAATGTAAGAAAGA
CAACAATTAGGTAGAACTGAAGGAGGGAGAGAGAATCCTCATATTATTAAAGAATAAATG
ATTCTTGAGAAAATGCTTGCAAAACAAAAAAGATATGATGAAATTATGTATGAAAAAGAA
AAGCTTGAATTTCTAAAAAAAACTAGAAAGATTCGCTAAAATCCAGAAGAATACAGGAAT
TTTATTAAGTGTTTTGTATTATGCGAAATTTCTTCTACTTTCTACTTTCTATAGTCTCAT
TTGGAAGATGAGTATTTAAAAGCTAAGATAATATCTTAATTTTCTTTAAAAGATTTAAAT
TTTTTACTTTCCATGAAAAACTATCCTGAAAAATACTCAACTAGAAGTATTATAAAAACT
GTTAATTATCACATATAGCAATACTTTACTTATAAATGGAAGAAAGAATAAATTGAATTT
CATAAAAATTTAGATGAAGGAATAGAGGTAGGCTACTCTTAAATGACATTAATTGCCTTG
ATCTTATTTGAATTTATTGGTATGAAAGTTAGATTTTCCAAAATTGTAGACATGAGATAC
CTCAACCTTGACAAAAAACACAATTCAAGGATCAAAGAAAGTAAAAGAAGTTCAAATTAG
TCTTAAGAATCCACACATAGCAATTAAAAGCGTACTAGAGAATCTATAGTAAGTAGTGTT
GTTTAAAATAAGAGAGCTGCACGTTTTTCAGATATGGCTTCTAGAATTACTGCTAAAATA
ATGAATTAGGTATAATAATTAGTTAAATATTAAAAAAAGGAATATTTATTTAATTTTTAT
AGACTTAAATGATAGAAGATTAAATAGATAGTGATTAAAGTGACAGTGATGATGAAGATT
ATTAAACAAAAAAAAATGATAAAAAATAATAATAAAAAGAAAGCAATGATTTATTTGACC
AAATGCTGTCAAATTTTAAGTTTGATAAAAAAAGCACTAACAATTCATCAATGATTAGTT
TTAGTAATTAAAAAAAAAATTAACAAGAAGAAGATTCAATTGTTTCAACTGCCTCATCTA
CCTTTTAGACTGATCCTAAAAAATTTGATTTTAGAAAGTATTTAAATAAAGGAAAAAAGC
AAGATGATGATAAAAGCTCCTTATTGAAAATAGATAACTAAACATAAAAATAAGAAGAAG
AAGAAATTAAATTAGTTAATAAAAAATTAAGTAATTTGAAGAAGTTAGATAGTTTATCTG
ATGGTAAATTAAAATTAGATAACATTAAATTTATTTTAATAATTAAATTTAATAGTAGAA
AAATGCGAAAGCGAAGTTGAAAAAGAAGAGGAAACTTTAAATCCATTTAATTTTGCTTTT
TCTAAAAAAAAATTTAAAAAGACTTAACAGGGTAGATTTTTAATTATTTTAATTTTAATT
AATTATGTCATTTTTTTAAGACTTAATATAGACTTAGTAGACAAATTAAACAGAATAGGA
TTCAAAGCTTTTGGAAAATGACTAAAATTAATAACAATAAAAGTTATTAAAAAGTGATTT
CTATCAAAGTTCTGAAATAAAGTATTGGCTTGAAGTTTATGATGAAAAGAGTTAGCAATG
GATTTGTTTTGATGCTGTTTAGAATGAAATTTTAGAAAGATTCTAAATTTTGTTAAAATA
AAATAGTATACCTGTTTTATTCATAGTTGGATATAATAAATTAGAATTTAAAAATGAAAA
ATTAAAAGAATATGTTCATAACAAAAGATCTATGAAAAATTTGTTTTTATTTGATATTAC
TGATATACACTGTGATAGGTATCCGAAAATTTAGGTAAGTAGAAGAGAGTTGAATTTCGA
TTATTGGTGGAAAAATCTTCTTTAACATGTTTCATTTCTTGGAAATCCAGAATTACTATA
AGACGAATATGTAAAATGTTATTTATAATAAATTATATTATTTATTATATAAAAAATAGA
AACCCTAAGTAATTAGTGAAAGAGAAACAAAAATATAAATGTAAAAATCTTAAATCCCTT
AATCATATCCTGAGTTTAAAGCAAGTGAAATTTATATTACTAAGTCAATGCTTTAAAAGT
ATTAAGGTTTACATCCAAATGCATAAAAGACAAATCTTACATTTAAAGACGAAGACGTAA
GCAACTATGCTATTAACATTTATTATAATAAATTAATAAAAAAAAGGTATATTTTAAAGA
ATATGTCGTTGATTTGCATGCAAAAACTAGATGGAGATCCTACTAAAGATCAGTTAAGCC
TGATGAGAAGCCTGTTAAATAGGTTCAATCGATTTTAGGTAACAAAAAAATGGTAGATTT
GTTTGGATTCTGGTAAACTGAAGAGTTAGTATACAAAATCAGAGATGATGGAACTCTCCC
AAGAAATGAATATGGTAACTGGGAGGTAATTTTAATTAAAATTATTATAATTTGTTTGTT
TGATTTAAATTAAATAAAAATAAAATTTAATTTAATTAAACTCTCTCTTTAAAATCAAAT
TCTTATTTAGACGTTTGCTGGTGATCCACCTGAAGGAACAGTTTTGATTGAAATCTAAGG
ATTACCTAAGTTGCTAAAAAAACATAACATAGAGTATGTAGAAGCAGTTTGCGGATTTGA
ATCGACAGCATCTGGTAGATCTCATGTGGTTAAAAATGGTATACTAGCCCACAAGAAAGA
TGAAGAAAGAATAAGATAAATTTATTAAGATAACTATGAAATTATGAAAGCTCAGTAAGC
AGAAAATCTTAAAAAAGAGCTTATGGGATTTTGGAGAAAAATATTTAAAGGAGTTTTACT
GAAAAAGAGTATTTCAGATAGATAAAATAAAATAAGTATGTGA


>TTHERM_00825460(protein)
MDSNEDLDFNDEFEEVDEKQNEDRISFGSDDENNQQKQSDSEDNLYFDNKIKNNKKQKNK
LEDSYEDDRMINEDENQDIDFLNAICNKDEEGQKNMREDFLSLIKTAGDDDTIQKLMQER
QQLGRTEGGRENPHIIKEQMILEKMLAKQKRYDEIMYEKEKLEFLKKTRKIRQNPEEYRN
FIKCFVLCEISSTFYFLQSHLEDEYLKAKIISQFSLKDLNFLLSMKNYPEKYSTRSIIKT
VNYHIQQYFTYKWKKEQIEFHKNLDEGIEVGYSQMTLIALILFEFIGMKVRFSKIVDMRY
LNLDKKHNSRIKESKRSSNQSQESTHSNQKRTRESIVSSVVQNKRAARFSDMASRITAKI
MNQTQMIEDQIDSDQSDSDDEDYQTKKNDKKQQQKESNDLFDQMLSNFKFDKKSTNNSSM
ISFSNQKKNQQEEDSIVSTASSTFQTDPKKFDFRKYLNKGKKQDDDKSSLLKIDNQTQKQ
EEEEIKLVNKKLSNLKKLDSLSDVEKCESEVEKEEETLNPFNFAFSKKKFKKTQQDLIQT
QQTNQTEQDSKLLENDQNQQQQKLLKSDFYQSSEIKYWLEVYDEKSQQWICFDAVQNEIL
ERFQILLKQNSIPVLFIVGYNKLEFKNEKLKEYVHNKRSMKNLFLFDITDIHCDRYPKIQ
VSRRELNFDYWWKNLLQHVSFLGNPELLQDEYKPQVISERETKIQMQKSQIPQSYPEFKA
SEIYITKSMLQKYQGLHPNAQKTNLTFKDEDVYFKEYVVDLHAKTRWRSYQRSVKPDEKP
VKQVQSILGNKKMVDLFGFWQTEELVYKIRDDGTLPRNEYGNWETFAGDPPEGTVLIEIQ
GLPKLLKKHNIEYVEAVCGFESTASGRSHVVKNGILAHKKDEERIRQIYQDNYEIMKAQQ
AENLKKELMGFWRKIFKGVLLKKSISDRQNKISM