Identifiers and Description

Gene Model Identifier

TTHERM_00829380

Standard Name

RPL11 (Ribosomal protein of the large subunit)

Aliases

PreTt14117 | PreTt14116 | 144.m00135 | RPL5-E.coli

Description

RPL11 60S ribosomal protein L11; Homolog of yeast RPL11(/RPL5)and E.coli RPL5

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00281 ) ribosomal protein L5
  • ( PF00673 ) ribosomal L5P family C-terminus

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10203.1 4.9996115996408327e-110
Description: 60S ribosomal protein L11 (173 aa)
Oxytricha Contig19511.0.g119 2.0008312485874125e-83
Description: ribosomal L5P family C-terminus
SGD YGR085C 1.9996609186508915e-82
Description: RPL11B Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl11Ap; involved in ribosomal assembly; depletion causes degradation of proteins and RNA of the 60S subunit; has similarity to E. coli L5 and rat L11
WormBase WBGene00004423 8.997777707990486e-82
Description: locus:rpl-11.2 status:Confirmed UniProt:Q19162 protein_id:CCD61193.1
DictyBase DDB_G0279189 9.998074580622396e-81
Description: rpl11 on chromosome: 3 position 1766422 to 1767386
Stentor Coeruleus SteCoe_23588 1.2160992992528256e-37
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00829380(coding)
ATGACCGACAAAAAGGAAAATAAGATGAGAGAAGTCAAGATCGCCAAGTTGGTTATCAAC
TGTTGCGTTGGTGAATCTGGTGATAAGCTTACCAAGGCTGCTAAGGTCTTGAAGGATTTA
TCCGGACAAGAACCCGTCTTCTCCAGAGCTAGATACACCATCAGATCCTTCGGTATCAAG
AGAAACGAAAAGATGGCTGTTCACGTTACCATCAGAGGTGATAAGGCCAGAGATATCCTT
ACCAGAGGTTTAAAGGTTAAGGAAATGGAACTTAGAAAGAAGAACTTCTCCAACACTGGT
AACTTCGGTTTCGGTATCTAAGAACACATCGATCTCGGTATGAAATATGACCCCTCTACT
GGTATTTTCGGTATGGACTTCTACGTCGTCCTTGAAAGACCCGGTACAAGAGTTGCTAGA
AGAAGAAGAGCTACCTCTAGAGTCGGTAACAACCAAATGATCTCCAAGGAAGAATGTATC
AACTGGTTCAAGACCGAATTCGAAGGCAACGTCTATTGA


>TTHERM_00829380(gene)
ATGACCGACAAAAAGGAAAATAAGATGAGAGAAGTCAAGATCGCCAAGTTGGTTATCAAC
TGTTGCGTTGGTGAATCTGGTGATAAGCTTACCAAGGCTGCTAAGGTCTTGAAGGATTTA
TCCGGACAAGAACCCGTCTTCTCCAGAGCTAGATACACCATCAGATCCTTCGGTATCAAG
AGAAACGAAAAGATGGCTGTTCACGTTACCATCAGAGGTGATAAGGCCAGAGATATCCTT
ACCAGAGGTTTAAAGGTTAAGGAAATGGAACTTAGAAAGAAGAACTTCTCCAACACTGGT
AATTTGTTAATCTTGTTTTTTTTCTGATAAATGCTTTTTTTCAGCTTCTTTCTTCTTTGT
TCTCCTGCAGCTAATAATCAATTATTCATTGATTCAAAGCATTTTGCTTAAAGCAAGATT
CCTTAAGAAAGCTCTTTTTATTTATTTCAATCTCAATAATTTCAACGGCTTAATTAATAT
TTATTTTTAAAACAGGTAACTTCGGTTTCGGTATCTAAGAACACATCGATCTCGGTATGA
AATATGACCCCTCTACGTAAGCTATTAACACAAACTCAAAAAAACAATCTTTTAAATTCG
TAGCATCTGCAAAGCTCACAAAAATAAATCAAGACAAAAATGCCCTAAAACAAAAAAAAG
CAATATAAAAAAGAAGCATCAAATATACAGCGAGTTTTTAAAGATTAAAAATGCAGTCTT
TAATTAAAAATTCATAATAAAATCAATATGATTTTCACTTAAAGCCTTGAAGATGCTGCA
ATTTAAAAATGAAATTTTCCTATTAAACATTAAAATAATCTTTCCTTTTAATTAATAATA
GTGGTATTTTCGGTATGGACTTCTACGTCGTCCTTGAAAGACCCGGTACAAGAGTTGCTA
GAAGAAGAAGAGCTACCTCTAGAGTCGGTAAGAGATCAATTACTTTTTAAATTGAATAAG
TTTAAATACTTCAATCTTATTTACTTCACATGCACGCCAATCAGCTTTCCTTCAAACTAT
CTATCTATCTATTAATAAATAAATAAACTGCTAAGATTAAAGATAATAAATAAATAAATA
AATAAATAAATAAAAGCTCAAAGAATAATACGAATAGTTAATCTAATAAAGTCAATAAAT
CTCATAGCAATTATTAAATTAAAGGACAAAAAAAAGTTGTTTATTTGAAGGATATGCATA
AAGTTTAGATGATAAAATTAGCTAAAAAACCAATAGAAAGTCTTAAAATTAAGCTCAACT
TGTAATTAAAATCTTTGTTTGCGTTTTCTAGCACTTTTGTGTTAAGAAATAAGGACTTTT
CTTGAAGTGAAATGGAAATTACTAACTCTACTATTATGCAGTCAAAACAATTTAAAATAA
TGCTAATATGAAAAATGAAACTATCCATTCAATATAGCAATTTTCATTAATTTAGTGAAT
CAAACAAAATAATTAATAAAATTAATAAGTGGTTCTTTTCGGATTTAAAAACCAACAAAT
CAATCAATGGTAAATTTATTGTTTTTTGGTTGGTTGGTTTGTTTGTTTGTTATGAGGCTG
ACTTAAAACGAAATTAGATTTAAACCTTTGAAAAATAAAAAGAATGATTGAATTTATATT
GCCTTAACTATTTGGGTTACGAGAATACTTAAGGAATAAATTAATGTGTTAAATAAAGAG
ATAGTTAGATGGATAAACTGTTTTGTAAGCTGTTAGAGAAATTTGGTAGCAGAAATAAGA
ACGATGCTTGCATAGAAATAAATTAGATTGGAATTTTTATACTTACTTTAACCTTTTTTT
GATATAATTAACTAATCAATTAATTAAATTATTAGGTAACAACCAAATGATCTCCAAGGA
AGAATGTATCAACTGGTTCAAGACCGAATTCGAAGGCAACGTCTATTGA


>TTHERM_00829380(protein)
MTDKKENKMREVKIAKLVINCCVGESGDKLTKAAKVLKDLSGQEPVFSRARYTIRSFGIK
RNEKMAVHVTIRGDKARDILTRGLKVKEMELRKKNFSNTGNFGFGIQEHIDLGMKYDPST
GIFGMDFYVVLERPGTRVARRRRATSRVGNNQMISKEECINWFKTEFEGNVY