Identifiers and Description

Gene Model Identifier

TTHERM_00833750

Standard Name

THD17 (Tetrahymena Histone Deacetylase 17)

Aliases

PreTt14158 | 144.m00121

Description

THD17 predicted protein; Transcriptional regulator; Sir2 family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF02146 ) transcriptional regulator, Sir2 family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10210.1 9.997093137033517e-262
Description: transcriptional regulator, Sir2 family protein (1549 aa)
Oxytricha Contig21344.0.g34 9.000751454575209e-33
Description: Sir2 family
Stentor Coeruleus SteCoe_30793 0.0000000000002543665647376923
Description: None
DictyBase DDB_G0270928 0.00000000006996681903814525
Description: sir2E on chromosome: 1 position 3398987 to 3400602
WormBase WBGene00004800 0.000000004999139696582238
Description: locus:sir-2.1 status:Partially_confirmed UniProt:D3YT50 protein_id:CBK19468.1
SGD YDR191W 0.00000030014504373857585
Description: HST4 Member of the Sir2 family of NAD(+)-dependent protein deacetylases; involved along with Hst3p in silencing at telomeres, cell cycle progression, radiation resistance, genomic stability and short-chain fatty acid metabolism

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82

Sequences

>TTHERM_00833750(coding)
ATGGAATAAACTGATAATAGCAACAAACAAACTTAGCAATAAGAAGAAACGAAAGATTAT
AGAAACTGCTCTTATGAAGAAGTCATGAAAATGATTGAAGAGACAAGATTGAATTGTTAA
AGGACAATGCAAATTTGCAACTAATCAATTTAAAGTATTGGAGAATCTATCAAAACGGTC
AATGAAGCAAAATAAAATATCGATGGCTTTTTCGATTAGTACAATTAAGCTATGAACAGC
TTGTGCGAGAAAATTGCTGGATCATTCTCAGGAATGAGTCGTTGTTTTTTAAAAAATGAG
AACACTGATAAGGAATTTGAAGATTCAAGATAAATAACAATCTAAGAAGGTGCATAGCTT
TTCAAAGACAAGAAAAAAGTTGTTTTTTTAACAGGAGCTGGCATTTCAGTTGCAAGTGGA
ATTCCAACATTTAGAGGAGTTGGTGCTGCACCTCTATTTGAAAAAGACGGTGTTACCTAT
TAAAATGAAGAAATTTCTACTTACAATTTTATGAAAAACAAACCAGATATTTTTTGGGAA
AGAAATTTGATATTCTTAGGAGGTTAATTGGGAAAGAAGTACAATGTATCTCACTTAAAG
ATTCAATAATTAGTCAATTAGTATAAATAAATCAAGACATCTTAACTTGGGAAGCAAAAT
GCTTATCAACCCTAAGCAGTAATTGTGACATAAAATACAGACGGTCTTCATTGCTAGGCA
TTTAATGAGTTAAATCCCAGAGAAACAAATTACATGAACAAAGATGATCCTCAATATGGA
TTTTGCCCTGATGTATTTGAAGTTCATGGTAGTAAAACTTTCCTTAGATGTGATAATTAA
GAATGCAAAGATTATGATAAAAAGTTTTTGTACCCATAAAAATATAATTCTTACAAAGAC
TTCATATGCGAAACTTGTAAAACTTAAGCTAGACCAAATGTGTTGTACTTTGATGAATCA
TATAATGAAAAAAATTATAGGATAAACACTTTGAAAGAATTAACTTCTGATATGGATCTA
TTGATATCTATAGGAACATAATTAGACACAGGATATGCTGCTTAAACTGTCAGTAGTGCA
GTTCAATAAAAGATTCCAGTCATAGAAATATCTTTAACACCAGTCATATAAAAAGGAGGT
CTAACTCTGAAAGGAAAAGCAGAAGAAGTTGTACCTCAATTATGTGATTTAGTAATGGAG
TTAAATAAATAATATTTGTAAAATAAATAATTACCCACACCACAACAAAAAGTAGCAACT
AAATCAATTGCTTAGAAAAGTTAAAACCCACTAAAAGATTAAAATTATAAAAGTAATAGC
AGTTTACAATCAACGAATACCAGCAACTCTTCCATTTCTACTAAAGTCTCAACTAATTCT
GCTAAACCTGCAGTAAAACCTCTTAATTAAAACCAAGCGAATACTAAAACTAATTAAAAA
CCATAAGTAAAATAAGTCAGTTCTACAAAGCCAAATGTTAAAATTGGTCTAACCACAAAG
GAAAAAAAGTGA


>TTHERM_00833750(gene)
ATGGAATAAACTGATAATAGCAACAAACAAACTTAGCAATAAGAAGAAACGAAAGATTAT
AGAAACTGCTCTTATGAAGAAGTCATGAAAATGATTGAAGAGACAAGATTGAATTGTTAA
AGGACAATGCAAATTTGCAACTAATCAATTTAAAGTATTGGAGAATCTATCAAAACGGTC
AATGAAGCAAAATAAAATATCGATGGCTTTTTCGATTAGTACAATTAAGCTATGAACAGC
TTGTGCGAGAAAATTGCTGGATCATTCTCAGGAATGAGTCGTTGTTTTTTGTAAGTATAT
CATTCACTTATTTAAACAACTAAATAAATTTTTTAAACATTAAAGAAAAAATGAGAACAC
TGATAAGGAATTTGAAGATTCAAGATAAATAACAATCTAAGAAGGTGCATAGCTTTTCAA
AGACAAGAAAAAAGTTGTTTTTTTAACAGGAGCTGGCATTTCAGTTGCAAGTGGAATTCC
AACATTTAGAGGAGTTGGTGCTGCACCTCTATTTGAAAAAGACGGTGTTACCTATTAAAA
TGAAGAAATTTCTACTTACAATTTTATGAAAAACAAACCAGATATTTTTTGGGAAAGAAA
TTTGATATTCTTAGGAGGTTAATTGGGAAAGAAGTACAATGTATCTCACTTAAAGATTCA
ATAATTAGTCAATTAGTATAAATAAATCAAGACATCTTAACTTGGGAAGCAAAATGCTTA
TCAACCCTAAGCAGTAATTGTGACATAAAATACAGACGGTCTTCATTGCTAGGCATTTAA
TGAGTTAAATCCCAGAGAAACAAATTACATGAACAAAGATGATCCTCAATATGGATTTTG
CCCTGATGTATTTGAAGTTCATGGTAGTAAAACTTTCCTTAGATGTGATAATTAAGAATG
CAAAGATTATGATAAAAAGTTTTTGTACCCATAAAAATATAATTCTTACAAAGACTTCAT
ATGCGAAACTTGTAAAACTTAAGCTAGACCAAATGTGTTGTACTTTGATGAATCATATAA
TGAAAAAAATTATAGGATAAACACTTTGAAAGAATTAACTTCTGATATGGATCTATTGAT
ATCTATAGGAACATAATTAGACACAGGATATGCTGCTTAAACTGTCAGTAGTGCAGTTCA
ATAAAAGATTCCAGTCATAGAAATATCTTTAACACCAGTCATATAAAAAGGAGGTCTAAC
TCTGAAAGGAAAAGCAGAAGAAGTTGTACCTCAATTATGTGATTTAGTAATGGAGTTAAA
TAAATAATATTTGTAAAATAAATAATTACCCACACCACAACAAAAAGTAGCAACTAAATC
AATTGCTTAGAAAAGTTAAAACCCACTAAAAGATTAAAATTATAAAAGTAATAGCAGTTT
ACAATCAACGAATACCAGCAACTCTTCCATTTCTACTAAAGTCTCAACTAATTCTGCTAA
ACCTGCAGTAAAACCTCTTAATTAAAACCAAGCGAATACTAAAACTAATTAAAAACCATA
AGTAAAATAAGTCAGTTCTACAAAGCCAAATGTTAAAATTGGTCTAACCACAAAGGAAAA
AAAGTGA


>TTHERM_00833750(protein)
MEQTDNSNKQTQQQEETKDYRNCSYEEVMKMIEETRLNCQRTMQICNQSIQSIGESIKTV
NEAKQNIDGFFDQYNQAMNSLCEKIAGSFSGMSRCFLKNENTDKEFEDSRQITIQEGAQL
FKDKKKVVFLTGAGISVASGIPTFRGVGAAPLFEKDGVTYQNEEISTYNFMKNKPDIFWE
RNLIFLGGQLGKKYNVSHLKIQQLVNQYKQIKTSQLGKQNAYQPQAVIVTQNTDGLHCQA
FNELNPRETNYMNKDDPQYGFCPDVFEVHGSKTFLRCDNQECKDYDKKFLYPQKYNSYKD
FICETCKTQARPNVLYFDESYNEKNYRINTLKELTSDMDLLISIGTQLDTGYAAQTVSSA
VQQKIPVIEISLTPVIQKGGLTLKGKAEEVVPQLCDLVMELNKQYLQNKQLPTPQQKVAT
KSIAQKSQNPLKDQNYKSNSSLQSTNTSNSSISTKVSTNSAKPAVKPLNQNQANTKTNQK
PQVKQVSSTKPNVKIGLTTKEKK